SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018552 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018552
Domain Number 1 Region: 331-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-51
Family SPRY domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 32-143
Classification Level Classification E-value
Superfamily Immunoglobulin 4.45e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 157-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000506
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018552   Gene: ENSMODG00000014829   Transcript: ENSMODT00000018885
Sequence length 525
Comment pep:novel chromosome:BROADO5:2:268717217:268726191:1 gene:ENSMODG00000014829 transcript:ENSMODT00000018885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMMGFLRSFLSRCLISLLILQMTVCVSEQFKVLGPTGPIVAILDTDVTLPCRLSPLMNA
EHMDIRWLRSQFYEAVFVFQNGREQVGEQLVEYMGRTEFISDFIKEGRVAVKIYNVKMSD
NGEYQCIFQEGDAYEKAVFEVKVASLGSAPRFHLEGYENGGIRLACTADGWFPQPQVQCR
DNRGGKLPFLSETQAQDEAGFFHVKTLIVVQDSSVRNVSCSIYNPLLGQGKTFSILLLEP
FFPKTSPWKKALIAIIPVVVILLGISIFFILKRGKKIKKLLQEKKEDQEYKGKGKKQSRG
KSGNFDQLQDDSLIIVAFQKKGSISMIQVNWRKQHFQALNVTLDPASAHPGLVLSRNGKF
MRVENAGKSAEETFSVLGREPITSGRHYWEVKVEMEIGNKATWHLGICRDSAKRSGGFRE
SPGMGFWAIGCSDGTFQPMISKQSVPPSLGKPPEQIGIFLDYEAGNVSFYNMTDGSHIYN
FSRASFSGPVRPYFSIQTLNTSFTICDVSDRPESIPAPSLETPVT
Download sequence
Identical sequences F7CHX1
ENSMODP00000018552 ENSMODP00000018552 13616.ENSMODP00000018552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]