SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018563 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018563
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.82e-98
Family STAT DNA-binding domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 137-332
Classification Level Classification E-value
Superfamily STAT 7.46e-54
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.89e-39
Family Transcription factor STAT-4 N-domain 0.00046
Further Details:      
 
Domain Number 4 Region: 587-702
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-34
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018563   Gene: ENSMODG00000014816   Transcript: ENSMODT00000018896
Sequence length 782
Comment pep:novel chromosome:BROADO5:2:194111894:194184231:-1 gene:ENSMODG00000014816 transcript:ENSMODT00000018896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLIQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLV
REATNCSSPAGNLADALSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RNQAQFSQLSQLSPQERLTRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEILTELNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSIGGNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSNNMEDYNNMAISWSQFNRENLPGWNYTFWQWFDGVMDVLRKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTKDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLGKAVDGYVKPQIKQVVPEFISASADSSGGTATF
MDQAPSPAVCSQSHYNMYPQNPDSVLDPDEDFDLDETMDVARHVEELLSRPMDSQWIPHT
QS
Download sequence
Identical sequences F7CHH2
ENSMODP00000018563 ENSMODP00000018563 XP_001366402.1.35504 XP_007482242.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]