SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018663 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018663
Domain Number 1 Region: 1174-1512
Classification Level Classification E-value
Superfamily NHL repeat 7.85e-25
Family NHL repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 1409-1503,1530-1647
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000124
Family SGL-like 0.059
Further Details:      
 
Domain Number 3 Region: 870-942
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000235
Family Pre-dockerin domain 0.063
Further Details:      
 
Domain Number 4 Region: 612-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000468
Family EGF-type module 0.081
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018663
Domain Number - Region: 710-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 679-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 581-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000466
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 743-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00173
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 546-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00177
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 516-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.041
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018663   Gene: ENSMODG00000014906   Transcript: ENSMODT00000019000
Sequence length 2639
Comment pep:novel chromosome:BROADO5:X:17646067:18377042:-1 gene:ENSMODG00000014906 transcript:ENSMODT00000019000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQMDCKPYQPLSKVKHEMDLAYTSSSDESEEGRKPGQPYNSRETLHEYNQELRLHCNSQ
SRKRKEVEKSTQEMEFCETPHILCSGYQTDLHGVSQHGYQLEMGSDVDTETEGGTSPEHA
LRMWMRGMKSEHSSCLSSRANSALSLTDTDHERKSDGETDMPNSPHNQFTFRPLPPPPPP
PHACTCARKPPPTADSLQRRSMTTRSQPSPAAPTPPTSTQDSVHLHNSWVLNSNIPLETR
HFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTFSRPAFTFNKPYRCCNWKCT
ALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGQLYENGVSKGNRGTESMDATYPPIG
GKVSDKTEKKVYQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQIMIHHPIYLKFNISLAKD
SLLGIYGRRNIPPTHTQFDFVKLMDGKQLQKQDPKNSEDSQPSPRNLILTSLQETGFIEY
MDQGAWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCA
RDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICMPGYK
GEVCEEEDCLDPMCSGHGICVKGECHCSTGWGGVNCETPLPVCQEQCSGHGTFLLDAGVC
NCESKWTGPDCSTELCTMDCGSHGVCSRGICQCEEGWVGPTCEERTCPAHCAEHGHCRDG
KCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQNGWHCVCQVGWSGTGCNIVM
EMVCGDSLDNDGDGLTDCVDPDCCQQSNCYITPLCQGSPDPLDLVQQSLPLLSQHPPQLF
YDRIKFLIGKDSTHVIPRDVSFDSRRACVIRGQVVAVDGTPLVGVNVSFLGHSDYGYTIS
RQDGSFDLVAIGGISVTLVFDRSPFLSEKRTLWLPWNQFIVVEKVTMQRATAASPACDIS
SLMIPNPIVLPSPLTSFGGSCPERGSVVPELQVVQEEIPIPSSFVKLSYLSSRTPGYKTL
LRILLTHSAIPMGMIRVHLTVAVEGRLVQKWFPAAINLVYTFAWNKTDIYGQKVSGLAEA
IVSVGYEYETCPDFILWEKRTVVLQGFEMDASNLGGWTLNKHHILNPQSGIVHKGNGENM
FISQQPPVIVTIMGNGHQRSVACTNCNGLAYNNKLFAPVALASGPDGSVYIGDFNFVRRI
FPSGNSISILELRNRDTRHSTSPAHKYYLAVDPVSEFLYLSDTNTRRVYRLRSLGETKDL
AKNFDVVAGTGDQCLPFDQSHCGDGGRASEAALNSPRGITVDRNGFIYFVDGTMIRKIDQ
NAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYILDNNIVLQISE
SRRVRIVAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGILYIAETDERKVNRI
QQVTTNGEISLVAGAPTDCDCKIDPNCDCFSGDGGYAKDAKLKAPSSLAVSPDGTLYVAD
LGNIRIRAIRKNRAHLNDMNLYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNS
DGDLGAIISNNGNSVHIRRDAGGIPLWLMVPGGQMYWLTISSNGVLKRVSAQGYNLALMT
YPGNTGLLTTKSNENGWTTVYEYDLEGHLTNVTFPTGEVSNYHSDLEKLTKVELDTSNRE
NVITATNFTATSTIYILKHDNTQSTYRVSPDGSLRVTFASGMEITLNTEPHILAGAVNPT
LGKCNISLPGEHNSNVIEWRQRKEQTKGNMSAFERRLRAHNRNLLSIDFDHITRTGKIYD
DHRKFTLRILYDQSGRPILWSPVSRYNEVNITYSHSGLVTYIQRGTWTEKMEYDQGGKII
SRTWADGKIWSYTYLEKGSILDAKQALYSKESLYSPSTVTAQSTKSVMLLLHSQRRYIFE
YDQSDCLLSITMPSMVRHGLQTMLSVGYYRNIYSPPDSSTSFIQDFTSDGRLLQTLYLGT
GRRVLYKYTKQSRLSEILYDTTQVTFTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGR
QIFRFSEEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVIN
YDLNQVITTTVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVEA
NITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITR
LGEIQYKMDEDGFLRQRGNDVFDYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLG
QHLQFFYADLGNPIRVTHLYNHSSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPL
AVFSSRGQVIKELLYTPYGDIYQDTYPDFQVVIGFHGGLYDSLTKLVHLGQRDYDVLAGR
WTTPNHHIWKHLNTFPKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPG
FPKPELESVELTYELLQLQTKTQEWDPGKTILGIQCELKKQLRSFISLDQLPMAPRYSDR
KCLEGGTHPRFAAIPSVFGKGIKFAIKDGIVTADIIGVANEDSRRIAAILNNAHYLENLH
FTIDGRDTHYFIKLGSLEEDLALIGNTGGRRILENGVNVTVSQMTSVMNGRDQERQHSW
Download sequence
Identical sequences F7FVG6
ENSMODP00000018663 ENSMODP00000018663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]