SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018696 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018696
Domain Number 1 Region: 30-480
Classification Level Classification E-value
Superfamily Cytochrome P450 9.17e-111
Family Cytochrome P450 0.00000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018696   Gene: ENSMODG00000014950   Transcript: ENSMODT00000019033
Sequence length 480
Comment pep:novel chromosome:BROADO5:2:268238202:268242434:1 gene:ENSMODG00000014950 transcript:ENSMODT00000019033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMLLSVVLLLVLLATLHWLWMRRTISPYHFPPLVPGFFHLFQADLPSHLQSLAQRYGPLY
RVHLGMQDVVVLNSKKAIEEALTKNWLDFSGRPQTFTNQEVSKNSHDLSLGDYTPLWKAQ
RKLARSALLYVQNTMEPIIGQMVQDLCKRLLAQAGSPVSIHKELSMFTGSIISFLSFGEK
RESVIQQFYSCIQELMVVWDSWQIQILDVLPILRVFPNSGLRKLRRLVKKRDRIVQEQLS
RHKETMVEGQIRDLTDYMLQKLREQAEGSNRLSEEHVHMALVDIFIGGMETMSSTLTWAL
AFLLHHPEIQRRLQEELDEELDSGSPGSLPNYRDRDRFPLLNATITEVLRLRPAAPLALP
HYTRQPSTICGFDIPKNTIVIPNIYGAHHDDRIWEQPYDFRPDRFLESEPSQAGIPFSCG
VRVCLGETMARFELFLILAQLLWTFKLLPVEGNASLPSLKPEFGAFMLKAPNFLVRLLPR
Download sequence
Identical sequences F7FI80
ENSMODP00000018696 ENSMODP00000018696 13616.ENSMODP00000018696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]