SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018703 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018703
Domain Number 1 Region: 468-1219
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.27e-248
Family Type II DNA topoisomerase 0.00000000000413
Further Details:      
 
Domain Number 2 Region: 70-299
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-61
Family DNA gyrase/MutL, N-terminal domain 0.00000027
Further Details:      
 
Domain Number 3 Region: 292-452
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.5e-40
Family DNA gyrase/MutL, second domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018703   Gene: ENSMODG00000014954   Transcript: ENSMODT00000019040
Sequence length 1636
Comment pep:novel chromosome:BROADO5:8:285891596:285981410:-1 gene:ENSMODG00000014954 transcript:ENSMODT00000019040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGGGGAAAAAAGGAGGGGAGGGSGAGGAGGGLTWVTLFDQNNAAKKEETESSNKNDS
SKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQSMWVYDEDVGMNCREVTFVPGLYKI
FDEILVNAADNKQRDKNMTCIKISIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQ
LLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWVNNMMKTSEP
KVKYFDGDDYTCITFQPDLLKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPV
NGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGR
HVDYVVDQIVGKLIEVVKKKNKAGVSVKPFQVKNHIWVFVNCLIENPTFDSQTKENMTLQ
PKSFGSKCQLSEKFFKAASNCGIIESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDA
NDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMEN
AEINNIIKIVGLQYKKSYEDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSL
LKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEA
KEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQF
LYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKV
AQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNLLQPIGQFGTRLHGGKDAASPR
YIFTMLSTLARLLFPSVDDNLLKFLYDDNQRVEPEWYMPIIPMVLINGAEGIGTGWACKL
PNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQEIGQNQYAVSGEIFVVDRNTVEIT
ELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLVQAEAAG
LHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLNYYSLRKEWLVGMLGAE
STKLNNQARFILEKIQGKITIENRSKRDLIQMLVQRGYESDPVKAWKEAQEKAAEEEETQ
NQRDDSSSDSGTTSGPDFNYILNMSLWCLTKEKVEELIKQRDTKGRELNDLKRKSPSDLW
KEDLAAFVEELDKVEAQEREDALAGMAGKAIKGKVGKPKIKKLQLEETMPSPHGRRIVPQ
ITSAMKADASKKLLKKKKGELDPTAVKVEFDDELSITPAEGAGEDSLTTSTPAPKGPKPK
REKKEPGTRVRKTPLSSNKSSAKKVKKRNPWSDDESKSESDLEETEPVIIPRDSLLRRAA
AERPKYTFDFSEEEDDADEDDNNDLEELKVKASPVTNDGDDEFIPSDGLDKDDYTFSPVK
PKVIPEKSSHDKKNQDFGNLFSFPSYSQKSEDDGTKFDSCEEDSAPVFSPSFALKSTEKP
PSKTVAAKKAKLSSDVPPKPKRLPKQKKVETTNSDSDSEFGIPKKTTPPKGKGRGAKKRK
VSGSENEGEYNPGRKTAKSTPGKKSKKASFDQDSDGDIFQADFPPEPPSLPRTGRARKEV
KYFAESDEDVDFAMFN
Download sequence
Identical sequences F7D0D3
ENSMODP00000018703 ENSMODP00000018703 XP_007505244.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]