SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018714 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018714
Domain Number 1 Region: 280-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-40
Family SPRY domain 0.00019
Further Details:      
 
Domain Number 2 Region: 103-164
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 12-78
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000106
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018714
Domain Number - Region: 155-186
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0523
Family Apolipophorin-III 0.0084
Further Details:      
 
Domain Number - Region: 207-274
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0942
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018714   Gene: ENSMODG00000014968   Transcript: ENSMODT00000019051
Sequence length 471
Comment pep:novel chromosome:BROADO5:8:287076255:287077667:1 gene:ENSMODG00000014968 transcript:ENSMODT00000019051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVGKKSLGREIKMAANMEMIQKLQREITCEICRTCFSQPVTLHCGHSFCQACLSCSLTLG
ATYFTCPQCRQFSQSTELPAINVCLEKLTNIGKQLIFLSLKSPESWSQCPTHKEAAKLFC
EEDQTFLCVHCSQTAEHATHTFSPIEEASHNYREKLQQILRDLEKHCKEVEKLLSQEERP
FVDSKLMITGEYGKFHIFLWKEKSHCLDRLKEEHRIREERISQHMQSLQEFMQELQKSIH
KPNAELLQDVKDLWRRSESRKSQRLQDVKPELRQYPITGMIEVLNRFRVDIRVDPQSSSP
YVIVSEDQRSLWAAEGWQGEPNHSEDPAHHYVFAEQTFNSGIHYWEVDVIQVPQWSLGIH
APCVKRSREGSQDSRDCVYVLRYIKVKDIYYLLTYPGLLNHQVKDPIPRIGIYLECSSGT
LAFYNALQSTLIYRFSLTGISRSVRPIFSPGPPLQGTKPGPMTLCSVNSRL
Download sequence
Identical sequences F7CGU7
13616.ENSMODP00000018714 ENSMODP00000018714 ENSMODP00000018714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]