SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018735 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018735
Domain Number 1 Region: 203-354
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-43
Family C-type lectin domain 0.0000227
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018735
Domain Number - Region: 115-214
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018735   Gene: ENSMODG00000014982   Transcript: ENSMODT00000019072
Sequence length 358
Comment pep:novel chromosome:BROADO5:3:463000015:463012080:-1 gene:ENSMODG00000014982 transcript:ENSMODT00000019072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDLVAPKSPEMSGLDEEELMPSGWSPFDLGTQRSQSPRSFPAPWLRRLGFPLLLAFFVL
SFILSIITLTQVFQNQRQYNSEQEVVQEKLKNLSDKLKGDQDLKAKDQPEASLFIQQLNK
TLNLRAKDQLEASQLIEQLNKTLNLRAKDQLEASQLIEQLNKTLTLRAKDQLEASQFIEE
LNKASQFIEELNKASQVIEQLSKASQFIEQLNKTLSTLCRPCPYEWKFYKDSCYYFSVTR
KPWEASQNTCEADGSNLGIISSSEEQNYLKKNAASNHQLWVGLSDKKKEGYWHWVDGTAL
GQVEHLKAAVHSFWNEGEPNNAGDEDCCELIPNGWNDASCSKENYWICEKKASPCPML
Download sequence
Identical sequences F7CGE0
ENSMODP00000018735 ENSMODP00000018735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]