SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018739 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018739
Domain Number 1 Region: 991-1306
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.16e-75
Family Complement components 0.00000000322
Further Details:      
 
Domain Number 2 Region: 1577-1729
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-38
Family Netrin-like domain (NTR/C345C module) 0.0017
Further Details:      
 
Domain Number 3 Region: 1448-1578
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.79e-36
Family Alpha-macroglobulin receptor domain 0.00052
Further Details:      
 
Domain Number 4 Region: 680-746
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 1.96e-16
Family Anaphylotoxins (complement system) 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018739
Domain Number - Region: 385-450
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0361
Family Carboxypeptidase regulatory domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018739   Gene: ENSMODG00000014979   Transcript: ENSMODT00000019076
Sequence length 1731
Comment pep:novel chromosome:BROADO5:2:268205002:268222321:1 gene:ENSMODG00000014979 transcript:ENSMODT00000019076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFWMLLWASSLFTLTVQEARLLIFSPSVVRLGVPLSVGLQLHGASKGQKVKGIIFLRN
PSGPLGHCSEDVPFTLDSDNDFQLLSLPVPLVHVQRCGLGKLLEAPIVQLVAQTSWLKSA
LARKTDTQGVNLFFSSRRGHLFLQTDQPIYNPGQRVRFRVFALDENMRPSTDTLTITVQN
SHGLQIRKKNMLSKHSIFQDDFVIPDISEPGTWRISARFSDSLGSNSSTEFEVKKYVLPN
FEVKIIPKESYILVAPDVDVQIQLNVQAKYVYGKSVQGVAYVRFGVLDENGEKKFLRGLE
KQSKLADGLCSITLSGNEIQKALHISGMDDLQGLRLYVAAAVIESPGGELEEAEHTSLRF
VSSPFSVDLSSTKRYFIPGAPFLLQGFVQHVSGSPAPGVLIKVSANSITSGVNSKIEVPK
VNTDQRGQFGIPINVPQGTQELQFTVSAGSSFPAEATFTAHSLPLGGPGFLSMDRLDLNP
PRVGQSFTVNLHAVGAEGVPFSHYYYMILSRGEIVSVHRVARGTLTSISVPVTSKIVPSF
RLVAFYYHNGQPVANSLKVDVQTGDCEGKLELRVDEAELRPGDRLRLNVHTDPSAIVALG
AVDTAVYAAGGRKHSPLHMKKVFNSMNSYDLGCGPGDGVNALKVFEAAGLMFSDGHQWTE
TKSSLRCPKEKSSRKRRNVDFQKAILQKVSQYVGKDKRCCHDGMTPLPMRRSCKDRAARV
RAPACRESFLSCCQFAEELRKKARTRVSTGLARVQDMWEEEEELLDEDDIPVRSFFPENW
LWMLLTENKAYKVDELVPDSLTTWEVHAVSLSPTKGLCVAQPVQVRVFREFHLHLRLPFS
VRRFEQLELRPVIYNYLNRSLSVNVQVSPVEGLCLAGGGGRVLKLELPPISARPVSFPVV
PTAAAAMSLKVLAQGPFGIGDAVAKILHIEREGAVQIKEYSYKLNPLDSRGRTLEIPGES
PSNAIPDGDFSSIVRVTASDPMDALGSGGALSPGGLGSLLRVPRGCAEQTMIYLSPTLAA
SRYLDKTEQWGKLPPEMKDHSFRKSDGSYGAWLHRESSTWLTAFVLKVLSVAQEQVDGSV
EGLRETAQWLLTKQLGDGSFQDPCPVLHRDMQGGLVGPDESVALTAFVVVALQQSLSAFQ
TSEDDPNKERTKEQLRRVEASISRADSFLVGKITAGLLGAHASAITAYALTLTKAPEDAQ
NMAHNNIMAMAQGSGDDLFWGPVAGSQNAVSPTASAGSASEPTTLAPALWVETTAYVLLH
LLLREGKAELADQTANWLTRQASFQGGFRSTQDTVVALSALSEYWIASHTTAETKLNVSL
STQGRQGTESHFIQLDNHQTLGVQEDLQFPLGSKITVKVGGNSKGTLKILRKFNILEEKN
TTCKDFKLEVTVTGSVQYSEASDDDYEDYEEEPQPGDDPSPLGPPVTPLQLFEGRRNRRK
REAPKVGTDKEQRVHYEVCIWRSDGIRFPGMAIVDITLLSGFHALQTDLEKLTSLSDRYV
SHFETQGPHVLLYFDSVSASRDCVGFEAVQEVPVGLVQPASAVLYDYYEPGQKCVVFYGA
PSKSKLLSTLCSGDVCQCAEGKCPRKHRITEVDKMEEKVRINYACYDPRVQYGFKVKVLR
AEDKVAFRLFETRITRVLHYTQDVKVAIGQTRNFLVRISCRLQLEPGKEYLIMGLDGVTF
DDKENPQYLLDSMTWIEEIPSEKNCQALRYRSACINLNEFLQQYETQGCQV
Download sequence
Identical sequences F7CGC3
ENSMODP00000018739 ENSMODP00000018739 13616.ENSMODP00000018739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]