SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018781 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018781
Domain Number 1 Region: 197-333
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.36e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 307-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.62e-36
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 496-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-32
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 1130-1183,1245-1379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-32
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 5 Region: 940-1122
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.36e-25
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 6 Region: 734-795
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000015
Family Fibrinogen C-terminal domain-like 0.0022
Further Details:      
 
Domain Number 7 Region: 705-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000271
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018781   Gene: ENSMODG00000015017   Transcript: ENSMODT00000019119
Sequence length 1540
Comment pep:novel chromosome:BROADO5:2:193599486:193616563:-1 gene:ENSMODG00000015017 transcript:ENSMODT00000019119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDEFSYYCSFISVQLLLFPSRLPCTLTGMMLSSIACGIFQSLYVPWSFCFSPYCLWRFP
ASSPLSLSHPVSRLSVLRERARSPGKRAREVGTRTGRGRLGDVRREDRKRLGGGREERVG
KKEGRRDREREEGRRGENERRFWTLKILKGTTESWTEPRALVGTMGTPLLCILLATVTGA
RGWGWYGCDEELVASLYYRSLGASSYYGFFTGPRFARLHGTSGWSPAIGDRNPWLQIDLM
KKHKIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDL
HYHITARYIRIVPLAWNPRGKIGLRLGLYGCPYKSDVLYFDGDDALSYRFPKGVSRTLWD
VFAFSFKTEEKEGLLLHSEGIQGDYVTLELKNAQLLLHMSLGSNPIHGRPAHTTVMAGGV
LNDLHWHYLRLDRFGRDVNLTLDGEVQRFLLNGDFEKLNLDNEMFIGGLVRARQKNLAYR
ENFRGCMENVIFNRVNIADLAVRGHSRISSEGKVAFRCLDPVPHPINFGGPHNFVQVPGF
PRRGRFAVSFRFRTWDLTGMLLFSSLSDGLGHVELMLSDGQVNVSIAQPARKKLQFAAGY
RLNDGFWHEVNFAAQENTAVISIDDVAGAEFRVSHPLQIRTGTSYFFGGCPKPASLWGCH
SNQTAFHGCMELLKVDGQLVNLTLVEFHRLGRYAEVLFDTCGITDRCFPNPCEHGGRCYQ
SWDDFICYCDLTGYKGEICHQPLYKESCEAYRLSGKTSGNFTIDPDGSGPLKPFVVYCDI
RENRAWTVVRHDRQWTTRVTGSSQERPFLGAIQYWNASWEEVSALANASQHCEQWLEFSC
YNSRLLNTAGGYPFSFWIGRNEEQHFYWGGSQPGIQRCACGLDKSCVDPTLYCNCDADEP
QWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLKPLRCYGDRNSWNTISFHTGASLL
FPPIRANYSLDVSFYFKTTAESGVFLENMAGRPWQWRRPYLRLELNTSRDVVFAFDVGNG
DENLTVHNEEVEFNDDEWHLVRAEINVKLARLRVDHGPWEIRPMPLQTYIWLEYDRPLTV
GSAEHKRRPFLGCLRAMRLNGITLNLEGRANASEGTSPNCTGRCLHPKLPCFHGGRCVER
YSYYTCDCDLTAFEGPYCNHDIGGFFEEGTWVRYNLQSALRSAAQEFSHMLSRPVPGYEP
GYVPGYDTPGYVPGYHGPGYQLPDYPRPGRPVPGYRGPVYNVTGEEVSFSFSTTSAPAVL
LYVSSFVQDYMAVLIKEDGTLQLRYQLGTSPYVYPLTTRPVTDGQSHSINITRVYRSLFI
QVDYFPLMEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRYNTPGFSGCLSGVRFNN
VSPLKTHFRAPRPFPRDISEALRVQGDLAESNCGAMPHSGLEVPPELDPWYLPPDFIYYH
DDGWVAIIIGFVVTLLLLGLIGLLVLFYLQNHRYKGSYHTHEPKATHDYHAASKAPLPPS
TPARAPAPQPQAQAPAPAPAPAPALRDQNLPQILEESRSE
Download sequence
Identical sequences F7BXG8
ENSMODP00000018781 XP_001365367.2.35504 ENSMODP00000018781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]