SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018873 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018873
Domain Number 1 Region: 267-509
Classification Level Classification E-value
Superfamily Caspase-like 2.84e-48
Family Caspase catalytic domain 0.000083
Further Details:      
 
Domain Number 2 Region: 121-204
Classification Level Classification E-value
Superfamily DEATH domain 3.06e-19
Family DEATH effector domain, DED 0.012
Further Details:      
 
Domain Number 3 Region: 34-105
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000765
Family DEATH effector domain, DED 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018873   Gene: ENSMODG00000015097   Transcript: ENSMODT00000019214
Sequence length 510
Comment pep:novel chromosome:BROADO5:7:171396300:171458579:1 gene:ENSMODG00000015097 transcript:ENSMODT00000019214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKAAWFLIEKRQPHAAPVPQCLGMTGHRMSAQVIHQVEEELDEDEKEVILFLCRDLAP
DLTTKLDLRDLLCTLNDKGKLSPAGLAELLYRVRRFDLLKRIMKTDKASVEASLIRYPKL
VSDYRVLMTQLSEDMDKSEVTSFVFLLRDYIGGGKPYKNKKHFLDVVIELEKVNLISPDK
LDLLEKCLKNIHRIDLKKKIQKYKQSALEANYVNGIPTSLPAVNLRDPVYGLMLKNGIKK
EERPTFGQRGISTEPLKLSIQESRKSLPQMADDIYRLRSQPLGVCLIIDCIGNDAETLTA
TFTSLGFEVQCHQCLRTEEIHKTLGQVACLTTHQDYDIFVCIVISRGNSEGIFGVNHQTY
PVFPLQQIKKPFTGDACPFLSGKPKLFFIQNYMVAEDQQESNNVLEVDGDGGKGSYLGQR
PGGSSVPQEADIFWSVCTVNVSVLERYPNSPSFYLRSLSQLLRRPEERCSLLSLHIDLNN
KIFDWNSRVIPEEQYSILLEHTLRKKIVLS
Download sequence
Identical sequences F7F390
ENSMODP00000018873 ENSMODP00000018873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]