SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018967 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018967
Domain Number 1 Region: 335-413
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.72e-25
Family Intermediate filament protein, coiled coil region 0.0000225
Further Details:      
 
Domain Number 2 Region: 108-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000994
Family Intermediate filament protein, coiled coil region 0.00049
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018967
Domain Number - Region: 157-248
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00259
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018967   Gene: ENSMODG00000015180   Transcript: ENSMODT00000019309
Sequence length 472
Comment pep:novel chromosome:BROADO5:7:173230817:173244089:-1 gene:ENSMODG00000015180 transcript:ENSMODT00000019309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSYSSSQRVSSYRRTFGGGPSFSLGSPLGSPSLSRAAFGSKGSSSSVSSRVYQVSRTS
GGAGGLGSFRSSRVGFPRAAASSSYGAGELLDFNLADAVNQEFLTTRTNEKVELQELNDR
FANYIEKVRFLEQQNSVLAAEVNRLKGREPTRIAELYEEELRELRRQVEVLTNQRARVDV
ERDNLLDDLQRLKARLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAF
LKKVHEEEIRELQAQLQEQQVQVEMDVSKPDLTAALRDIRAQYETIAAKNISEAEEWYKS
KVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFAS
EANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINL
PIQSFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Download sequence
Identical sequences F7BWE5
ENSMODP00000018967 ENSMODP00000018967 13616.ENSMODP00000018967 XP_001362548.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]