SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018969 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018969
Domain Number 1 Region: 217-470
Classification Level Classification E-value
Superfamily Caspase-like 4.04e-85
Family Caspase catalytic domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-31
Family DEATH effector domain, DED 0.0037
Further Details:      
 
Domain Number 3 Region: 100-181
Classification Level Classification E-value
Superfamily DEATH domain 9.89e-18
Family DEATH effector domain, DED 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018969   Gene: ENSMODG00000015183   Transcript: ENSMODT00000019311
Sequence length 472
Comment pep:novel chromosome:BROADO5:7:171635121:171687760:1 gene:ENSMODG00000015183 transcript:ENSMODT00000019311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMDFHTFLYGIAEEIDSADLASLKFLCLDQIPLKKQQHIKDALVLFQTLEERGLLEEDN
LFFLKELLFRINRIDLLNEPLNTKGPEMERELQVPNKARISPYRILLFNLSEGVGPSELK
SIKFMLSSKIPKCKIEDDMTLMDLFIEMEKRGILGEGNLDALKIVCDQIDKSLLKKIQEY
EISKERSMERFPVEIQDVEETMSQPQEVYDSAGEKGNVYKMSSRPRGYCLIINNFDFKIS
RKERPENHYLTDRRGTNKDEEALKNIFKELHFDIQSFQDLTAEGIQQVLKTFKDNNHESK
DCFVCCLLSHGNKGTIYGIDGKEVPIRDLTSYFSGSNCPSLAGKPKVFFIQACQGKATQY
GISLDTDSEQQRESLEADKSFQSECIPNEADFLLGMATVENYVSYRDSARGTWYIQSLCK
NLKEGCLRGNDILTILTEVNSEVSQKTDPKNNGKQMPQPKITLRKKLVFPIS
Download sequence
Identical sequences F7BWD5
XP_007501681.1.35504 XP_007501682.1.35504 XP_007501683.1.35504 XP_007501684.1.35504 ENSMODP00000018969 ENSMODP00000018969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]