SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018981 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018981
Domain Number 1 Region: 30-123,271-492
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.54e-108
Family Bacterial dinuclear zinc exopeptidases 0.0013
Further Details:      
 
Domain Number 2 Region: 124-271
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.65e-35
Family Aminopeptidase/glucanase lid domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018981   Gene: ENSMODG00000015193   Transcript: ENSMODT00000019323
Sequence length 504
Comment pep:novel chromosome:BROADO5:7:173306094:173313856:1 gene:ENSMODG00000015193 transcript:ENSMODT00000019323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKDGILEAETMAPGAGERGSETGGEASVTSRAKKEAVQTAARELLKFVNQGPSPFHVVA
ECRSRLLQAGFQELKEAEKWDLKPERKYFVTRNFSTIIAFAVGGQYSPGNGFSLIGAHTD
SPSLRVKRRSLRNQAGCQQVGVETYGGGIWSTWFDRDLTVAGRVLIKSPSSDRIEQRLVH
VERPILRIPHLAIHLQRNINENFGPNPETHLLPILATAVQRSWRRGCSTQSSTISEMAES
RTDRHQPVLMSLLSAQLGQSAEDIVEMELCLADTQPGVLGGAYEEFIYAPRLDNLHSCFC
ALQALIDSCSAPASLASDPHVRMIALYDHEEVGSESSHGAASLLTELVLRRISASPQNLT
AFEEAVPKSYMISADMAHAVHPNYMDKHEENHRPLFHKGPVIKVNNKQRYASNAVSEALI
REVASRVGVPLQEFMVRNDSPCGSTIGPILAARLGLRVLDLGSPQLAMHSIREMACTSSV
LQTLTLFKGFFELFPVVNHNFAVN
Download sequence
Identical sequences F7BVS3
ENSMODP00000018981 ENSMODP00000018981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]