SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019028
Domain Number - Region: 157-228
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019028   Gene: ENSMODG00000015233   Transcript: ENSMODT00000019371
Sequence length 691
Comment pep:novel chromosome:BROADO5:8:187219644:187224214:-1 gene:ENSMODG00000015233 transcript:ENSMODT00000019371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQVRLKDVVRAYKSLLKEKEALEASLKVLS
ASQEADDAGLPAVQSPGLPLAESVDDRCSTHSEDSTGTATSLDTTASLTSTKGDLGMEEE
RLAIGLPPPKSEETSGSESGISSSSGDVPASGGGEIDKRLHQLKTQLATLTSSLATVTQE
KSRMEASYQADKKKMKQDLEDASRKAEEEKSRLEGELKGLQEQMAETKARLITQQHDRAQ
EQSDHALMLRELQKLLQGERTLRQDIELQLEETREALAGQAYSANQVEGFELQIKQLTGE
VEELKHELQALREEKNQPDPRLEELQEEAAHIKNHFQALLQQEMRKTALAEEQLLQYSKM
EEQRVAALENQVSEVSELLGTYEKAKQKDQLAIQKLKDRLLQLDMENKTLALAASSRSPL
DSHNEETSLDVNVLKDKMEKLRRLLQIAARKSQVSLNMEKLCDLDLLTNSDAADGEKATA
LYYQQELKQLKEEFERYKMRAQVVLKSKTTKDGNLAKELEDSQEQLAELKEKYISLRLSC
EELERQHQQEAESWKQELAQLQQAHRQELEKSQLDFRDRTLKLEEELHKQRDRALAVLAE
KDLELEQLRSVALCSGLQGHKASVSQGSTGDLSDSTPDSLTQALHLAASNEPTFFLYAEQ
LARKEVEITSLRKQKHKLEVERTSDIMVTFK
Download sequence
Identical sequences F6V2U1
ENSMODP00000019028 ENSMODP00000019028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]