SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019064 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019064
Domain Number 1 Region: 76-405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.00000382
Further Details:      
 
Domain Number 2 Region: 1378-1442
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1460-1592
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000192
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019064
Domain Number - Region: 934-1043
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0212
Family Myosin rod fragments 0.0054
Further Details:      
 
Domain Number - Region: 625-814
Classification Level Classification E-value
Superfamily Tropomyosin 0.0347
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 1031-1125
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.0098
Further Details:      
 
Domain Number - Region: 448-611
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019064   Gene: ENSMODG00000015257   Transcript: ENSMODT00000019408
Sequence length 2055
Comment pep:novel chromosome:BROADO5:3:508441009:508615259:-1 gene:ENSMODG00000015257 transcript:ENSMODT00000019408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKYGIRSPLDSSATEPISSRASRLNLLFQGKTPFMTQQQMSLLSREGILDALFVLFE
ECNNPALMKIKHVSNFVRKYSETIAELRELQPGLKDFEIRSLVGCGHFADVQVVREKATG
DIYAMKVMKKRSLLAQEEVSFFEEEQSILCRSTSPWIPQLHYAFQDKQNLYLVMEYLPGG
DLLSLLNRYEDQLDENMIEFYLAELVLAIHSVHQMGYVHRDIKPENILIDRTGHIKLVDF
GAAAKMTTNKMVKSKLPIGTPDYMAPEVLTVMNGDGKGIHGPECDWWSLGVIAYEMVYGR
SPFTEGTTAKTFNNIMNFQRFLKFPDSPKVSSEFLDLIQSLLCGPKERLSYESLCCHPFF
SKIDWNNIRNSPPPFFPTLKSDDDTSNFDEPERNSRALPFPGQLNPGGFSGEDLPFVGFS
FSRALGILGRAESVVSGLDSPAKISSMEKKLLIKSKELQDTQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATECQNKLMKAKDQGKVEVGELYSKLEKVNAEQQLKIQELQEKLAKAVKASSEATELL
QNIRQAKERAEGELEKLRNREDSSEGMRKKLFEAEERRHSLENQVKRLETVERRENRLKD
DIQTKSQQIQQMADKILELEEKHREAQVSAQHLEVHLKQKEQLYEEKIKVLDNQIKKDLA
DKETLENMMQRHEEEAHEKSKILSEQKAMINAMDSKIRSLEQRIVELSEANKLAANSSLF
TQRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKISHQDHSDKSRLLELETR
LREVSLEHEEQKLELKRQLTELQLSLQERESQLSALQSARTALESQLRQAKTELEETTAE
AEEEIQALTAHRDEIQRKFEALRNSCTVITDLEDQLNQLTEDNAELNNQNFYLSKQLDEA
SGATDELVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTCTMLEEQVMDLEALNDELL
EKERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRLRADQRITESRQVVELAVKEHK
AEILALQQALKEQKLKAESLSDKLNDLEKKHTMLEMNARSLQQKLETERELKQRLLEEAT
KLQQQMDLQKNHIFRLTQGLQEALDRADLLKTERSDLEYQLENIQVLYSHEKVKMEGTIS
QQTKLIDFLQAKMDQPAKKKKVPLQYNELKAALEKEKARCAELEEALQKTRSELRSAREE
AAHRKAADHPHPSTPATARQQIVMSAIVRSPEHQPNPISLLAPPSSRRKESSTPEEFNRR
LKERMHHNIPHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATCG
LPAEYATHFTEAFCRDKMNSPGLQLKEPSTNLRLEGWMKVPRNNKRGQQGWDRKYIVLEG
SKVLIYDSEAREAGQRPVEEFELCLPDGDVSIHGAVGASELANTAKTDVPYIMKMESHPH
TTCWPGRTLYLLAPSFPEKQRWVTALESVVAGGRVSREKAEADAKLLGNSLLKLEGEDRL
DINCTLPFSDQVVLVGTEEGLYALNVLKNSLTHIPGVGAVFQIYIIKDLEKLLMIAGEER
ALCLVDVKKVKQSLAQSHLPAQPDITPSVFEAVKGCHLFAAGKIENGLCICAAMPNKVVL
LRYNENLSKYCIRKEIETSEPCSCIHFTNYSIIIGTNKFYEIEMKQYTLEEFLDKNDHSL
APAVFASSSNSFPVTIVQVNSAGQREEYLLCFHEFGVFVDSYGRRSRTDDLRWSRLPLAF
AYREPYLFVTHFNSLEVIEIQARSSLGTPARAHLEIPNPRYLGPAISSGAIYLASSYQDK
LRVICCKGNLVKESSGEHPRGASTSRSSPNKRGPPTYNEHITKRVASSPAPPEGPSHPRE
PSTPHRYREGRTELRRDKSPGRPLEREKSPGRMLSTRRERSPGRLFDESSRGRLPVGAVR
TPLSQVNKVWDQSSV
Download sequence
Identical sequences F6U368
ENSMODP00000019064 13616.ENSMODP00000019064 ENSMODP00000019064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]