SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019080 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019080
Domain Number 1 Region: 663-931
Classification Level Classification E-value
Superfamily RNI-like 3.34e-59
Family 28-residue LRR 0.0036
Further Details:      
 
Domain Number 2 Region: 15-91
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-17
Family Caspase recruitment domain, CARD 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019080
Domain Number - Region: 193-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00987
Family G proteins 0.064
Further Details:      
 
Domain Number - Region: 191-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0301
Family G proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019080   Gene: ENSMODG00000015275   Transcript: ENSMODT00000019424
Sequence length 938
Comment pep:novel chromosome:BROADO5:8:294436101:294473151:1 gene:ENSMODG00000015275 transcript:ENSMODT00000019424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRVLPDGKAPGPPSFMKLLKVDRELLVTHIRNVQCLLDNLMANDYFSMEDAEIVGACP
TPPDKVRKMLDLVQSKGEEVCEYLLHVLQQIPDAFVDLKPWLAERGFWPSELVRSRVVVN
TDPVSRYTQKMRLEWGRDSKFIKSYTQREEMLLADTYTEHIMELVDFHDAALGGVSSLDS
LLVDSTGVINVDGETVFVVGDAGVGKSVLLQQLQNSWASSEPGAGPRFFFPFRCRTFGCF
PPAAALSLRELLFSHSCCPELEPDAVFEFLLRFPATALFTFDGLDELQSDLDLSRLPDVA
SPLQPAPPVALLASLLRGKLLPGAGKVLTARTGVELPRALVRKKVRLRGFGPEQLRAYTR
KVFPELAEQQRVLSQLDASPQLSSLCSVPLFCWIIFRCLRGGPGPQLATELPLTLTDVFL
LLAEAHVSRTMPSSPLRSDPQHSQAETFHTGRGPLCALGRLAYWGLARNRFVFGPEQVAA
SQLPEGALQLGFLRLVPEPGPLGPQAAYEFLHLTLQAFFAALFLVADDSVGTAKLLRFFG
EGTARRGLRGLGCLGGCHGGKKDPFRNNDHCQFTNLFLCGLLSKAKQELVQHLVPPATLR
RKRRALWSHLAASLRSYLKGLPRTQAGEFLQVQAMPTFIWMLRYIYEAQSQRVSRLAARG
ICANYLKLAYCNTCSADCSALAFVLHHVPKQLALDLDNNNLCDYGVKELRPCFGRLTVIR
LSVNRIADAGARVLSEELTKYKIVTFLGLYNNQITDVGATYVAKILEECPGLTHLKIGAN
LLTSEGGKCLAAALKKSRSILDIGMWGNKIGDEGAKAFADALRDHPSLATLSLAFNGIST
EGGKSLAQALQQNSSMKIFWLTKNNLDDEAAESLAEMLEVNQTLNDLWLIQNQITAKGLS
RLADALQKNSSILDICLSGNPIKPEEAKVFQHDKRFHF
Download sequence
Identical sequences F6TM17
ENSMODP00000019080 ENSMODP00000019080 XP_001381520.3.35504 XP_007505312.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]