SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019129 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019129
Domain Number 1 Region: 84-139
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000183
Family AN1-like Zinc finger 0.0016
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000222
Family AN1-like Zinc finger 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019129   Gene: ENSMODG00000015318   Transcript: ENSMODT00000019474
Sequence length 251
Comment pep:novel chromosome:BROADO5:7:173422203:173425414:-1 gene:ENSMODG00000015318 transcript:ENSMODT00000019474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGAHCSEATCQRLDFLPLKCDACSGIFCADHVAYDQHHCGSAYQKDVQVPVCPLC
NVPVPVARGESPDRAVGEHIDRDCRSDPAQRKRKIFTNKCSRPGCRQREMMELTCERCGR
NFCLKHRHPLDHECPGNKLPSSQPGLAAISRAQGLGSSPAPVPGQGLGRTSSPSESRVAE
SPTHALQNGLSEDEALQQALILSLTENKSSAPSSQEEEDLALAQALSASEEEYRKQQAQS
RSLKPSNCSLC
Download sequence
Identical sequences F6XYA9
ENSMODP00000019129 13616.ENSMODP00000019129 XP_001362727.1.35504 ENSMODP00000019129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]