SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019189 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019189
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.32e-122
Family Bee venom hyaluronidase 0.0000192
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019189
Domain Number - Region: 432-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0186
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019189   Gene: ENSMODG00000015370   Transcript: ENSMODT00000019536
Sequence length 481
Comment pep:novel chromosome:BROADO5:8:181971036:181983855:1 gene:ENSMODG00000015370 transcript:ENSMODT00000019536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLSERRLILHIVQPSYLTSWLLVSFILKPIASLKPAQLPIYQRKPFIAAWNAPTDQCS
TKYNIMLNLKMFHIIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNFSLQA
HLEKAGQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNTKDVYRQKSRKLISEVKVNMSA
SEIEYLAKISFEESAKAFMKETIQLGIRSRPRGLWGYYLYPDCHNYNIYDQNYTGSCPED
EVLRNNELSWLWNSSAALYPSIGVKKSFGNSGNILRFSQFRVNESMRISTMTSHDYALPV
FVYTRLGYRDEPLYFLSKQDLISTIGESAALGAAGIVIWGDMNLTSSEGNCTKVKQFVTS
DLGSYIVNVTKAAEVCSRRLCRNNGRCVRKIWKAADYLHLNPDNCQIEVSDDGDFAVKGE
PSDSDLKVMAERFSCHCYQGYGGKDCREMKTSGHHSGVSPSSGSRIGQCLLVLVYYLNLQ
C
Download sequence
Identical sequences F6WHI3
ENSMODP00000019189 13616.ENSMODP00000019189 ENSMODP00000019189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]