SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019192 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019192
Domain Number 1 Region: 41-363
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.68e-121
Family Bee venom hyaluronidase 0.00000723
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019192
Domain Number - Region: 425-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0232
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019192   Gene: ENSMODG00000015371   Transcript: ENSMODT00000019539
Sequence length 484
Comment pep:novel chromosome:BROADO5:8:181920805:181928465:1 gene:ENSMODG00000015371 transcript:ENSMODT00000019539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVSVKTTNLQMKWLLMLVFSFAVNAKTLKESNPPIIEYKPFIVYWNIPTTMCKKRFGVD
LNLQAFDIIANPDETLNGPYVTIFYEKKLGHYPYINEIGEMFNGGIPQNEKLSKHLEKST
GDIKNIIPGSKFQGLAVIDWEEWRPQWDRNWGPKNIYRIQALNHIKNLHSELSESKMQAA
AKQEYESAAKSFMNSTIRLGSALRSQGHWGFYLYPECYNYDYKKKPETYTGKCPEIEITR
NDGLQWLWQASTALYPSIYLPLALRNSPHTQKFVHYRVKEAMRISYKAKKDYALPVFVYT
RLFYTYGLEPLTKNDLLYTIGESAAMGAAGIVIWGGMDHSNSRNSCLSMQKFVNGVFGHY
IVNVTAATQRCSRILCNNNGRCVRKQSESFSYLHMPMGSIMRHKLKKGLKFFPSQRASKE
HIQYMKNEFICQCYTHWNGKVCAWKDNHHSGSRQLTLCSDTNIFFSLILMLPLTLLIFFY
PTIL
Download sequence
Identical sequences F6WH69
ENSMODP00000019192 ENSMODP00000019192 XP_007504304.1.35504 XP_007504305.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]