SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019193 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019193
Domain Number 1 Region: 62-503
Classification Level Classification E-value
Superfamily Cytochrome P450 3.8e-92
Family Cytochrome P450 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019193   Gene: ENSMODG00000015372   Transcript: ENSMODT00000019540
Sequence length 509
Comment pep:known chromosome:BROADO5:7:173926961:173963838:-1 gene:ENSMODG00000015372 transcript:ENSMODT00000019540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNLGSLVMRGRLAQLLVPLRMVPPRCPLGARAKAVDPTALPPELAEAPGAVSSTAGPEA
RQLRSLDELPGPGQLHSLFRLFVQGYVLHLHELQVVLKSKYGPIWKLPLLPYTSVYLANA
SLMEQLLRQEGKHPLRHDMALWKEHRDSRGFAYGPFTTEGEEWYQLRQALNSRMLKPSDA
ALYTDSLNEVIGDLLVQLEDIKAKSLSGDQVPDVANFFYFFALEAITYILFEKRIGCLKP
PIHPEMETFVKSVGLMFKNSLYVTFLPKWTRPLFPFWNRYLENWDIIFTFGKKLIEEKLK
DMAAELKDGNSDKIRMSGYLHFLLSSGELTPDEAVGSLAEILLAGVDTTSNTMTWALYHL
AQDPETQEALYKEVVGVVPPGKIPQYKDFAHMPLLKAVLKETLRLYPAVPTNSRVNSEKD
VIVGDFLFPKNTQFVLCHYAMSHDPDIFPSPKKFLPKRWLRRNQTGPVGVNHAFGSIPFG
YGVRACLGRRIAELEMYLVLSRVRDGGNW
Download sequence
Identical sequences F6WH61
ENSMODP00000019193 ENSMODP00000019193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]