SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019257 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019257
Domain Number 1 Region: 386-521
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-39
Family Gelsolin-like 0.000042
Further Details:      
 
Domain Number 2 Region: 16-143
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-37
Family Gelsolin-like 0.00000391
Further Details:      
 
Domain Number 3 Region: 247-433
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.52e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.009
Further Details:      
 
Domain Number 4 Region: 609-728
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-35
Family Gelsolin-like 0.0000392
Further Details:      
 
Domain Number 5 Region: 505-607
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.26e-25
Family Gelsolin-like 0.00026
Further Details:      
 
Domain Number 6 Region: 750-824
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 6.93e-24
Family VHP, Villin headpiece domain 0.0000888
Further Details:      
 
Domain Number 7 Region: 121-230
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.12e-18
Family C-terminal, gelsolin-like domain of Sec23/24 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019257   Gene: ENSMODG00000015428   Transcript: ENSMODT00000019604
Sequence length 824
Comment pep:novel chromosome:BROADO5:7:174215747:174241748:-1 gene:ENSMODG00000015428 transcript:ENSMODT00000019604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NDKAQCQVKNSLNITTPGVQIWRIEAMQMVPVPSNTYGNFFDGDCYIVLAIHKTGNTLSY
DIHYWLGKDSSQDEQGAAAIYTTQMDDFLKGRAVQHREVQGYESDTFRAYFKQGLVYGGV
ASGMKQVKTNSYDIQRLLHVKGRNVVAGEVEMSWKSFNRGDVFILDLGKLIIQWNGPESN
RMERIKGMNLAKEIRDQERGGRAYVGVVDGDHEADSPELMEVMKHILGQRKELKAAIPDN
VVEPALKAALKLYHVSDAEGKLVVREVATHPLTQDLLNHEDCYILDQGGLKIYVWKGKDA
NSEERKGAMNQALEFIKAKKYPPSTQVEIQNDGAESAVFQQLFQKWIIPNRTSGLGKTHT
VGSVAKVEQVKFDAESLHVRPEMAAKQNMVDDGSGEVEVWRIENLELVPVESRWLGHFYG
GDCYLLLYTYLINEKKNYIIYIWQGRSATQDEITASAYQAVTLDQKYNDEPVQIRVPMGK
EPPHFMAIFKGRMVVYQGGTSRAGNNEPVPSTRLFQVQGTNDKNTKAFEVPARASSLNSN
DVFILKTQSCCYLWYGKGCSGDEREMAKSVSDIISRTEKLVVVEGQEPANFWIALGGKAP
YANNKRLQEENLSIVPRLFECSNQTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIG
MYANEAEKNAAAVMVQEYLKTHPSGRDLETPIVVVKQGHEPPIFTGWFMAWDPFKWDNMV
SYEDMKAELGNNSHLSQITAEITNPKPDVFNANTNLSPGPLPTFPLDMLMNKSAEELPEG
VDPSRKEEHLSGEDFTRVFGMSPAAFSALPRWKQQSLKKEKGLF
Download sequence
Identical sequences F6SML3
ENSMODP00000019257 ENSMODP00000019257 13616.ENSMODP00000019257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]