SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019264 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019264
Domain Number 1 Region: 350-379,467-580
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-33
Family Netrin-like domain (NTR/C345C module) 0.015
Further Details:      
 
Domain Number 2 Region: 261-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.034
Further Details:      
 
Domain Number 3 Region: 380-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019264
Domain Number - Region: 50-143
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000723
Family APC10-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019264   Gene: ENSMODG00000015434   Transcript: ENSMODT00000019611
Sequence length 583
Comment pep:novel chromosome:BROADO5:6:163642421:163648129:-1 gene:ENSMODG00000015434 transcript:ENSMODT00000019611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCPLSQTPLGTRTMLGPMLWLLAAWMLAPVLSASPQVPTDPCYDEAGAPQRCIPEFVNA
ALGREVQASSTDPRQAHPAAFLTDASAAADRTCWRSETLTRTPLNVTLTLPLGKAFEVVY
VSLHFCSSRPDSAAVFKSQDHGRSWSPLRFFSSQCNRVYGRPSRAMGQAPAQASLGSVVP
RGPEALCSEPPPRTGPLLAFSMQDGLPPGQDLDSSPVLQDWVTATDIRVVLSRPVGPRAA
EGGVVAPYVYSVGELQVGGRCKCNGHASRCVVDTQGRLVCDCRHGTEGPDCERCKPFYCD
RPWQRATAHEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCR
EGFYRDQTRVLSHRRACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQS
RSPVAPCVKIPAMVPTGVTSTVAPEDCDSHCKPARGSYRINLKKYCGKDYAVQVAVGSAE
AVGAWTRFSVAVVSVYKSGEERARRGESVLWVPARDLACRCPRVHPGHSYLILGGTGPGA
GVGERAGLTAGRGSLVIPWRDAWARRLRKLQRRERQGRCGGAA
Download sequence
Identical sequences F6SLT4
ENSMODP00000019264 XP_001370742.1.35504 ENSMODP00000019264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]