SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019385 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019385
Domain Number 1 Region: 675-968
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-74
Family Protein kinases, catalytic subunit 0.000000273
Further Details:      
 
Domain Number 2 Region: 58-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-17
Family MAM domain 0.042
Further Details:      
 
Domain Number 3 Region: 20-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000969
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019385   Gene: ENSMODG00000015531   Transcript: ENSMODT00000019733
Sequence length 1204
Comment pep:novel chromosome:BROADO5:1:511192311:511390553:-1 gene:ENSMODG00000015531 transcript:ENSMODT00000019733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCVSALPGMPPISKMALKSSFTCWNGTAIHLGQACNFQRDCSEGEDEGELCKALPAGF
YCDFEDGDCGWIQGMTMPQTPQWQVGILTDAPFPNHQGYTMLFNTSKASPAETVVLTSNM
FPAPMKNSPCELQMLWLIHGSLEGNVSLMLMENKTGKEQSQTIWYFANREGLGIWQRMVL
PLPDVSDRFWLQIVTWWEEGSGAIIAFDNISLSLDCYLTINGEEKISKDEAPNSSNLFDI
NSYKKPLQDPRSKKTSHGEILNFDPTVQWLFTTCGASGPQGPTQTQCNNAYRNSNLSVVV
GSEGVLKGVQIWRVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGVFDLEKDDFLYIL
VGQQGEDACPSTSEIIQKVCIGENNVIEEEIRANQSVNEWAGGGGGGGGATYIFKMKNGI
PVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWSGK
SLLEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAAVNNDPEVDGED
GVSFISPLGILYTPALKVMEGHGEVNIKLYLNCSHCEVDECHIDPESHKVICFCEHGTVL
AEDGVSCIVSPPSEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQ
SPEYKLSKLRTSTIMTDYNPNYCFAGKTTSISDLKEVPRKNISLIRGLGHGAFGEVYEGQ
VSGIPSDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFI
LLELMAGGDLKSFLRETRPRPNQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARN
CLLTCSGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWS
FGVLLWEIFSLGYMPYPSKSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQCWQHLPEDRP
NFATVLERIEYCTQDPDVINTALPIEYGPVTEEEEKVPMRPEDPDRIPPLLVSPQQEKKE
AACAPSAPPPLATTSSGKPLKKALALEPPVRITRGAPVEGGHINMAYSQSNPPSELHKGR
GSRNKPTSLWNPTYGSWFTEKSAPKNSPRAEPEQPERGKAGPEGHCTPGPPGRLPGSSLL
LEPSSLTSSMTEVPLFRLRHFPCGNVHYGYQQQGLPLEAGATPAAAGYGDSALRNPSGGS
QAGP
Download sequence
Identical sequences F6VHJ5
ENSMODP00000019385 ENSMODP00000019385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]