SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019507 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019507
Domain Number - Region: 25-132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00204
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number - Region: 443-507
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.00373
Family Double Clp-N motif 0.011
Further Details:      
 
Domain Number - Region: 248-460
Classification Level Classification E-value
Superfamily Tropomyosin 0.0438
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019507   Gene: ENSMODG00000015629   Transcript: ENSMODT00000019856
Sequence length 828
Comment pep:novel chromosome:BROADO5:3:54248667:54546281:1 gene:ENSMODG00000015629 transcript:ENSMODT00000019856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGVVLKYGNDSSAELSELHLAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQGEQ
SHLLREHEDVQERMTLRYEERITELHSIIAELNKKIDRLQGTTIREEDEYSELRSELSQS
QQEVNEDSPSLDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLTGLENVVCGRKKSS
CGLSVAEVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAEERSRCEKELAGLRE
ENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQAAGPSSPGRLTS
TNRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSEISSIGVSGSV
AEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNSRIEHLKSQNDLLTIT
LEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESEQSLILGQFRAA
GVGSVGDQTRDENVTQMLKHAHDCRKTAENAAKALLMKLDGSCGGAFAVPGCSVQPWESL
SSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSYD
VKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYL
VHIEHLKSEVEEQKEQKMRSLSSTSSGSKEKTGKECIDGASSVPSLTELRTTFSENDLAA
EVTNALRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKK
KHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL
Download sequence
Identical sequences F7FEU0
XP_007486649.1.35504 ENSMODP00000019507 ENSMODP00000019507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]