SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019587 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019587
Domain Number 1 Region: 511-779
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.84e-95
Family BC ATP-binding domain-like 0.000000478
Further Details:      
 
Domain Number 2 Region: 1908-2184
Classification Level Classification E-value
Superfamily Aspartate/ornithine carbamoyltransferase 2.88e-88
Family Aspartate/ornithine carbamoyltransferase 0.000000609
Further Details:      
 
Domain Number 3 Region: 1044-1302
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.42e-84
Family BC ATP-binding domain-like 0.0000119
Further Details:      
 
Domain Number 4 Region: 1463-1737
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 6.81e-74
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.000062
Further Details:      
 
Domain Number 5 Region: 149-360
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.85e-53
Family Class I glutamine amidotransferases (GAT) 0.0000521
Further Details:      
 
Domain Number 6 Region: 2-148
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 7.32e-52
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000598
Further Details:      
 
Domain Number 7 Region: 774-924
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 9.15e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00019
Further Details:      
 
Domain Number 8 Region: 929-1045
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.16e-45
Family BC N-terminal domain-like 0.0000255
Further Details:      
 
Domain Number 9 Region: 386-510
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-43
Family BC N-terminal domain-like 0.0000367
Further Details:      
 
Domain Number 10 Region: 1309-1465
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.83e-24
Family Inosicase 0.027
Further Details:      
 
Domain Number 11 Region: 1737-1805
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 3.42e-17
Family Hydantoinase (dihydropyrimidinase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019587   Gene: ENSMODG00000015693   Transcript: ENSMODT00000019936
Sequence length 2185
Comment pep:novel chromosome:BROADO5:1:508476607:508529018:1 gene:ENSMODG00000015693 transcript:ENSMODT00000019936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVLEDGSVLRGQSFGAAVCAAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLVGNY
GIPPDEEDEFNLSQWFESSGIHVAGLVVGECCSTPSHWSATRTLHQWLEEHGIPGLQGVD
TRELTKKLREQGSLLGKLVQDGIEPSSLPFLDPNARALVPEVSIKEPRIYNARGSPRILA
LDCGLKYSQIRCLCQRGAEVTVVPWDYKLDSHEYEGLFLSNGPGDPASCPNVVSMLSNVL
SEPDPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLKGSGRCFLTSQNHGFAVE
TESLPPGWTPLFTNANDLSNEGIVHETLPFFSVQFHPEHRAGPSDMELLFDIFLETVKEN
RAGGKTVRERLMERLCPSGTPTPRDMPPSPRKVLILGSGGLSIGQAGEFDYSGSQAIKAL
KEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALN
CGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQA
AAERLGYPVLVRAAFALGGLGSGFASSREELSSLVAPAFAHTSQVLVDKSLKGWKEIEYE
VVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVG
ECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGISLPDLRNSVT
GGTAAFEPSLDYCVVKVPRWDLSKFLRVSTRIGSCMKSVGEVMAIGRGFEEAFQKALRMV
DENCVGFDHTMKPVSDMELETPTDKRIFVVAAALWAGYTIDRLYELTRIDRWFLQCMKRI
IEHTRKLEEHRGQPLPPDLLHQAKRLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQI
DTVAAEWPAQTNYLYLTYGGTTHDLAFHAPHVLVLGSGVYRIGSSVEFDWCAVGCIRQLR
KMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNM
AMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGY
PCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACD
GMVVAVAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQL
IAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEEVEPVGLMAGTGVVGVKV
PQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYK
NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVEGECPPQRSILEQ
LAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQI
GPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAM
PNTRPPIIDAPALALAQKLAETGARCDYALFLGASSENAGTLGAVAGAAAGLKLYLNETF
SELQLESISHWMEHFETWPHHLPIVAHAERQTVAAILMVAQLAQRPVHICHILLIKAAKA
RGVSVTCEVAPHHLFLSQADLERLGPGKGEVRPELGTLEDVEALWENMAIIDCFASDHAP
HTLEEKSGSKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQKLHHNPRRIFHLPQQEDTY
VEVDLEHEWIIPSHMPFSKAHWTPFEGQRVKGTIRRVVLRGEVAYIDGQVLVPPGYGQDV
RKWPQGPVPQHLPSAPPSESIKTPERPRRGLPGHPDGRFHLPPRIHRASDPGLPAEEPKE
KPSRKTVEPDLAGTPDSCCYPPPVPRQASPQNLGTPSLLHTQTSPLLHSLVGQHILSVRQ
FTKDQMSHLFNVAHTLRMMVQKERSIDILKGKVMASMFYEVSTRTSSSFAAAMARLGGSV
LNFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGE
HPTQALLDVFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRM
PPDVLSFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFGQFILTPHI
MTRAKKKMVVMHPMPRVNEISVEVG
Download sequence
Identical sequences F7E0R2
ENSMODP00000019587 ENSMODP00000019587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]