SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019625 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019625
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00858
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 211-351
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0661
Family Laminin-type module 0.086
Further Details:      
 
Domain Number - Region: 716-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family Laminin-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019625   Gene: ENSMODG00000015728   Transcript: ENSMODT00000019975
Sequence length 1133
Comment pep:novel chromosome:BROADO5:3:56391896:56489444:-1 gene:ENSMODG00000015728 transcript:ENSMODT00000019975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVYLNSFLDFPFILFYLWIGMTLSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESMEICIPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDRDHWGPHCSSRCQCKNGALCNPITGACHCASGFKGWRCED
HCEQGTYGNDCHQKCQCQNGATCDHVTGECRCPPGYNGAFCEDLCPPGKHGSQCEERCPC
QNGGVCHHVTGECTCPDGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDSAIGQCHCSP
GYTGERCQDECPVGTYGMQCAEICQCINGGKCYHISGACLCEPGYTGEHCEARLCKEGVY
GIKCDRKCPCHLKTTQSCHPVSGECSCKPGWSGLYCNETCTLGFFGESCQQLCSCQNGAD
CDSVTGKCFCAPGFKDSTCSTPCPLGTYGINCSSQCNCKNGATCSPVDGSCTCKAGWHGV
DCSINCPSGKWGFGCNLTCECRNGGACSALDGTCTCAPGWRGEKCEFACQDGTYGLNCME
RCDCSHADGCHPTTGYCRCLPGWSGIHCDSVCVEGHWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQKCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCGGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAYCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGKHCEQKCPPGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGTRCDQAGILIVGNLN
SLSQTSTANPANSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKEKESNMPAVTYTPAMR
VITADYTISDTLPQSNGGNTNNHYFTNPSYHTLTQCSTSPHVNNQNRMAVGKSKVNQIFV
NIKNVDPGKEGPILDFTGTLPVNWKHGNFHNELGAFGLDREYMRKSLKDLVKNSDYNSSN
CSLNSSENPYATIKDPPVLIPQTSESGYVEMKSPVHRDSPYAEISSSASTNKNVYEVEPT
MITIQEVFSNNGPLSQDPYDLPKNSHIPCHYDLLPVRDTSSSPKKEVTSSSSE
Download sequence
Identical sequences F7B542
XP_007486673.1.35504 ENSMODP00000019625 ENSMODP00000019625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]