SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019674 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019674
Domain Number 1 Region: 24-211
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 9.01e-46
Family Class I glutamine amidotransferases (GAT) 0.0000563
Further Details:      
 
Domain Number 2 Region: 198-464
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.82e-42
Family N-type ATP pyrophosphatases 0.0001
Further Details:      
 
Domain Number 3 Region: 577-689
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 2.75e-22
Family GMP synthetase C-terminal dimerisation domain 0.001
Further Details:      
 
Domain Number 4 Region: 436-558
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 0.000000000000288
Family GMP synthetase C-terminal dimerisation domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019674   Gene: ENSMODG00000015770   Transcript: ENSMODT00000020028
Sequence length 689
Comment pep:novel chromosome:BROADO5:7:245937154:245988427:-1 gene:ENSMODG00000015770 transcript:ENSMODT00000020028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPQLENAGGDLQDGRHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAI
KEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKNVR
EDGVFNINVDNTCSLFRGLQKEEIVLLTHGDSVDKVAEGFKVVAQSGNIVAGIANESKKL
YGVQFHPEVGLTENGKAILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVLVLLS
GGVDSTVCTALLNRALDQDQVIAVHIDNGFMRKRESQSVEEALRKLGIQVKVVNAAHSFY
NGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMNLRPEEVFL
AQGTLRPDLIESASLVASGKAEVIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRILGR
ELGLPEELVSRHPFPGPGLAIRVICAEEPYVCKDFPETNNILKIVADFSASVKKPHTLLQ
RVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKEDPDWESLM
FLARLIPRMCHNINRVVYVFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHSILRESGY
AGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIAATPGNEIPVEAVLK
MVTEIKKIPGISRVMYDLTSKPPGTTEWE
Download sequence
Identical sequences F6ZS89
ENSMODP00000019674 ENSMODP00000019674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]