SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019706 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019706
Domain Number 1 Region: 545-814
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-95
Family BC ATP-binding domain-like 0.000000328
Further Details:      
 
Domain Number 2 Region: 1087-1351
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-87
Family BC ATP-binding domain-like 0.0000109
Further Details:      
 
Domain Number 3 Region: 190-400
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.36e-50
Family Class I glutamine amidotransferases (GAT) 0.0000356
Further Details:      
 
Domain Number 4 Region: 809-968
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 9.15e-49
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00013
Further Details:      
 
Domain Number 5 Region: 43-194
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 1.44e-46
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.00011
Further Details:      
 
Domain Number 6 Region: 970-1088
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.31e-41
Family BC N-terminal domain-like 0.0000307
Further Details:      
 
Domain Number 7 Region: 418-544
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.5e-39
Family BC N-terminal domain-like 0.0000358
Further Details:      
 
Domain Number 8 Region: 1359-1494
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.07e-25
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019706   Gene: ENSMODG00000015793   Transcript: ENSMODT00000020060
Sequence length 1499
Comment pep:novel chromosome:BROADO5:7:184151334:184300444:-1 gene:ENSMODG00000015793 transcript:ENSMODT00000020060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRILTACKVIKTLKTGFCNGNAQRQWKVSRTGVRLLSVKAQTAHIVLEDGTKMKGYSFG
HPSSVAGEVVFNTGLAGYPEAITDPAYRGQILTMANPIVGNGGAPDTAALDEMGLSKYLE
SDGIKVAGLLVLNYSEEFNHWLATKSLGKWLQEEKIPALYGVDTRMLTKIIRDKGTMLGK
IEFEGQPVEFVDPNKQNLIAEVSTKDVKVYGKGNPVRVVAVDCGIKQNVIRLLVKRGAEV
HLVPWNHDFTKMEYDGLLIAGGPGNPALAQPLIQNVKKIFESDRKEPVFGISTGNLITGL
AAGAKTYKMPMANRGQNQPVLNITNRQAFITAQNHGYALDNNTLPAGWKPLFVNVNDQTN
EGIMHESKPIFGVQFHPEVSPGPTDTEYLFDSFLSLIKKGKGTTVTSVLPKPALVASRIE
VSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADA
VYFLPITPQFVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESI
MFTEDRQLFSDKLNEINEKIAPSFAVETIDDALKAADKIGYPVMIRSAYALGGLGSGICP
NKESLLDLGTKAFAMTNQILVERSVTGWKEIEYEVVRDSADNCVTVCNMENVDAMGVHTG
DSVVVAPAQTLSNAEFQMLRQTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSR
SSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRF
HGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTSRLPMNKDWPSNLDLRT
ELAEPSSTRIYAIAKAIDDNMPLDEIVKLTSIDKWFLFKMRDIINMEKNLKGLNSDSIPE
ETLKKAKEIGFSDKQISKCLGLTEAQTRELRVKKNIHPWVKQIDTLAAEYPSVTNYLYVT
YNGQEHDVKFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVS
TDFDECDKLYFEELSLERILDIYQQEACSGCIISVGGQIPNNLAVPLYKNGVKIMGTSPL
QIDRAEDRSIFSAVLDELKVAQAPWKAVNTLKEALEFAKSVGYPCLLRPSYVLSGSAMNV
VFSEDEMKKFLAEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGV
HSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVRGNDVLVIECNLRAS
RSFPFVSKTLGVDFIDVATKVMIGENIDETNLPTLNHPIIPADYVAIKAPMFSWPRLRDA
DPILRCEMASTGEVACFGESIHTAFLKAMLSTGFKIPQKGILIGIQHSFRPRFLGVAEQL
HNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSPIRKLIKEGNIDLVINLPNN
NTKFVHDNYVIRRTAVDSGIALLTNFQVTKLFAEAVQKSRTVDSKSLFHYRQYSSGKTA
Download sequence
Identical sequences F7FS26
ENSMODP00000019706 XP_001369265.1.35504 ENSMODP00000019706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]