SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019830 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019830
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.45e-47
Family Crotonase-like 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019830   Gene: ENSMODG00000015892   Transcript: ENSMODT00000020185
Sequence length 254
Comment pep:novel chromosome:BROADO5:6:157676236:157686812:-1 gene:ENSMODG00000015892 transcript:ENSMODT00000020185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELGIATMKMNNPPVNSLSLELLTNFVIDLEKLENEKRCRGLIITSASPKIFSAGLDITEM
YGKSSAHYAEFWKAVQELWLKLYMSNMVVIAAINASCLFGSSPAGGCLISLAGDYRIMAD
NPKYTIGLNETLLGIVAPFWFKDTLVNTIGNRASEHALQLGLLFSPTDALRVGIVDQVVP
EDKVQDTALNVMSRWLSIPDHARQLTKTMMRKPTVDRLLKQREADIKNFVSFISRDSIQK
SLHMYMKHLKERKE
Download sequence
Identical sequences F7AGN8
ENSMODP00000019830 ENSMODP00000019830 13616.ENSMODP00000019830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]