SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019972 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019972
Domain Number 1 Region: 299-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-50
Family SPRY domain 0.0000584
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000164
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 80-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019972   Gene: ENSMODG00000016004   Transcript: ENSMODT00000020329
Sequence length 469
Comment pep:novel chromosome:BROADO5:2:266506355:266522733:1 gene:ENSMODG00000016004 transcript:ENSMODT00000020329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTPSLQIIHEEVDCPICIGIPKDPVSAPCGHIFCRSCLTSPSTMGAHPSRLCPICKEK
RQPEVHQPWGWATENLKILGPIGETHCDEHGEKIYFFCEKDGEFLCVLCREGSNHQAHAV
VLLDEATRPYRERLRSRLEDLCLEKKEMEDMKSGEDQKLQVLLTQIESKKQHVEEVFKQL
QKVLQVQQHLLLDQLGELEKEIRKERTHYIAMISEKIAQLGAHIKELEGKCQQPANELLK
DVRMTLNRYEKGTFINPEPISSGLVRRIRDLHQKICVLPEMTGKFSENLLLHLETNTGGI
TLDPQTASGSLIISEDRKSMRYTRKKQNLPENPQRFDGFPAVLGSQGFSSGNHSWEIEVV
LGDGGGYTVGVAQEDMERKGEMGLSTEEGIWAVIFSSQQCWASTTPGTDLPLCEIPQRVR
VTLDYNGGHVTLSDAETQTTIFTFPASFSGKIFPFFAVWKKGSRLTLKP
Download sequence
Identical sequences F7EGF6
ENSMODP00000019972 XP_001375273.1.35504 ENSMODP00000019972 13616.ENSMODP00000019972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]