SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019973 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019973
Domain Number 1 Region: 304-499
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-44
Family Reprolysin-like 0.00031
Further Details:      
 
Domain Number 2 Region: 516-591
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.93e-16
Family Blood coagulation inhibitor (disintegrin) 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019973
Domain Number - Region: 746-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019973   Gene: ENSMODG00000016005   Transcript: ENSMODT00000020330
Sequence length 837
Comment pep:novel chromosome:BROADO5:7:188741137:188984847:-1 gene:ENSMODG00000016005 transcript:ENSMODT00000020330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGISALRQPSPGCSLLASSSSSSFSTTTISSPSCWQPPPLLLHTLCRLRLLLLLQLL
SGSFWSQPWGAAAASASSWNETAKETAGALADEENAFQQNSSRRNNNSYSNAVQKEITLP
SRLVYYINQDSESPYHVLDTKARYQQKHNKAVHLAQASFQIEAFGSRFILDLTLNNGLLS
SDYVEIHYEDGKPQFSKGGEHCYYHGNIRGIKDSKAALSTCNGLHGMFEDNTFMYMIEPL
ELIHNTKSTARPHIIQRTLGGHTSKQLNNLSMEEHDQWPFLSELQWLKRRRRRRAAPRGV
FEEMKYLELMIVNDHKMYKKYRSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTE
KDYIDIRSDPVQMLHEFSKYRQRIKQHADAVHLISRVIFHFKRSSLSYFGGVCSKTRGVG
VNEYGLPMAVAQGLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKC
SILEYKDFLQRGGGFCLFNRPTKLFEATECGNGYVEAGEECDCGFHVECYGVCCKKCSLS
NGAHCSDGPCCNSTTCLFQPRGYNCREGVNDCDITETCTGDSGQCPPNLHKQDGYSCNSN
QGRCYNGECKTRDNQCQYIWGSKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDV
FCGFLLCTNLTRVPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCG
PSMMCLDRKCLQIQSLNMSSCPLDSNGKVCSNHGVCSNEVTCICNNTWAGTDCSIRDLIK
KAPASKDDGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPSQQGPI
Download sequence
Identical sequences F7EGE6
ENSMODP00000019973 ENSMODP00000019973 XP_001370554.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]