SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019993 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019993
Domain Number 1 Region: 52-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.23e-73
Family Lectin leg-like 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019993   Gene: ENSMODG00000016022   Transcript: ENSMODT00000020350
Sequence length 350
Comment pep:novel chromosome:BROADO5:1:503202143:503229604:1 gene:ENSMODG00000016022 transcript:ENSMODT00000020350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVPRFSGRRWLWQGPGTRPVRAGFGTLLLLLLLGSGPGLRPAGADQTDEYLKREHSLS
KPYQGVGTSSSSLWTLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCYLRDWELQVHFKIH
GQGKKNLNGDGFAIWYTKDRMQPGPVFGSKDNFVGLGVFVDTYPNEEKQQERVFPYVSAM
VSNGSLSYDHERDGRPTELGGCTAMVRNLNHDTFLVIRYVKRRLTIMLDIDGKHEWRDCI
DVPGVRLPRGYFFGTSSVTGDLSDNHDIISLKLFELTVERTPEEEKLHRDVFLPSVDNMK
LPEVTLPMEPLSGLALFLIVFFSLVAAVFALVIGIIVYNKWQDQSRKRFY
Download sequence
Identical sequences F7EFW8
ENSMODP00000019993 ENSMODP00000019993 XP_007475956.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]