SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020005 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020005
Domain Number 1 Region: 59-172
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-20
Family V set domains (antibody variable domain-like) 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020005   Gene: ENSMODG00000016030   Transcript: ENSMODT00000020362
Sequence length 272
Comment pep:novel chromosome:BROADO5:2:266311039:266330541:1 gene:ENSMODG00000016030 transcript:ENSMODT00000020362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGHVSEALYLFSSLYLGFLFSGSIEMRNLPRSSLPGYLISFFFLFLLQLPSTYSGQFRVI
GQDHPTQAFVGGLIELSCHLSPAKNATGMEIGWYRSPFSRVVHLYRNGKDQDAEQAPEYR
DRTKLVKDAIGEGKVTLRIKHVRFSDEGGYTCFFRDHSYQEEAAMQLKVEDPFYWLNHGI
LVLIAVLPILILQITIGLGFLYMQHRLRGKLQAEIENLHRTFDPYFLRVPCWKIALFVIV
PVLGPLAAMIICYNWLHRRLAGQFLEELSKFI
Download sequence
Identical sequences F6ZHT5
13616.ENSMODP00000020005 ENSMODP00000020005 ENSMODP00000020005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]