SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020036 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020036
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000077
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.53e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000149
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-34
Family Spermadhesin, CUB domain 0.0000187
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 641-793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-24
Family MAM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020036   Gene: ENSMODG00000016052   Transcript: ENSMODT00000020393
Sequence length 929
Comment pep:novel chromosome:BROADO5:7:189781596:189934324:-1 gene:ENSMODG00000016052 transcript:ENSMODT00000020393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTFHLLWVSLALSFSGPGVTGEAGLPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSRNFTSMNGTIESPGFPDKYPHNLDCTFTIL
AKPKMEIILQFMTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSKLRS
STGILSLTFHTDMAVAKDGFSAHYYLIPQETPENFQCNVPLGMESGRISNEQISASSTYS
DGRWTPQQGRLHSDNNGWTPNVDSNKEYLQVDLRFLTILTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMMYRHGKNHKVFQANNDATEVVLNKIHTSVLTRFIRIRPQTWHTGIAL
RLELFGCRITDAPCSNMLGMLSGLISDSQITASSTREYLWSPGVARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGVPKTVKGVIIQGARGGDTITAVEARAFVRKFKVSYSLNGKDWEYIED
PRTQQPKLFEGNMHYDTPDIRVFDPVPAQYVRVYPERWSPAGIGMRLEILGCDWTDTRPT
VETLRPTLKNEETTTQYPTDEETTDCGENCSAEEDKDFQPPPGFNCNFDFMEESCGWMYD
HEKWLTSTWTGSSSPVDNAPPDGRTYLRLQSNGRREDQHGRLISPALYLPRSPVCMEFQY
QATGGSGIALQVVRKASQASKLLWVIREDQGSEWRQGRIILPSDEMEYQIVFEGILGKGR
SGEIAIDDIRIGTDIPLENCMEPITAFPVDIPEIPRIINSERYEDDDEDEYEVDWSNTSS
PTTGPGLPKEDREKSWLYTLDPILVTIIAMSSLGVLLGAICAGLLLYCTCSYTGLSSRSC
TTLENYNFELYDGIKHKVKINHQKCCSEA
Download sequence
Identical sequences F6YTS8
ENSMODP00000020036 XP_007501939.1.35504 ENSMODP00000020036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]