SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020037 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020037
Domain Number 1 Region: 328-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 2 Region: 860-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 967-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 4 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 261-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 814-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 7 Region: 502-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 415-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 9 Region: 920-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 10 Region: 1130-1177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 766-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 12 Region: 1019-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020037
Domain Number - Region: 1077-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000642
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020037   Gene: ENSMODG00000016055   Transcript: ENSMODT00000020394
Sequence length 1761
Comment pep:novel chromosome:BROADO5:8:159958333:160076643:-1 gene:ENSMODG00000016055 transcript:ENSMODT00000020394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFFWVQVLLSLSEVQDGCHNGSCHPTVGDLLVGRSDQLTASSTCGLDGPQKYCVLGYLE
EQQKCFICDSRFPYNPYTQANSHMIENVITTFEPDRKKKWWQKKNSLDNVSIRLDLETLF
QFSHLILTFKTFRPAAMLVERSMDYGQTWKVFRYFAKDCAASFPNIPSGQAQGVDDLICD
SKYSDFEPSTEGEVVLKALDPNFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDVLLGRR
PSDPLDKYYYALYDMVVRGRCFCNGHAKECGPIQHVRGDVFSPPGMVHGQCICQHNTDGP
NCERCKEFFHDVPWRPAEGLQDNACRSCNCNGHSEHCHFDMSLYLSSNGISGGMCEDCQH
NTMGQHCDQCKPLFYRDPLKAISDPHACIPCECDPEGSLSGGMCESYPDPALGIEAGQCL
CKDNVGGAQCDQCKPGYYGLNANDPLGCQPCNCNPLGSIPFSICDVVTGRCLCQPFVTGP
HCEKCLDGYWGLESHQHGCSPCDCDVGGAYSNLCSPHDGQCECRPHVIGHQCTEPEPGYF
FVPLDFYIYEAEDAVPIPGSAPLVPVTLGSKSLDQTVIREPIPGKPVTWTGPGFTQVLSG
TSLRFTINNIPFAMDYAIVIRYEPQSPADWAARVVINPSGTPRSEHCRYKAFPQEPQTLA
LPASGRTALLATPVCLQPEIQYSIDVHFSQSFTMDSLAHGHILIDSLGLIPQMDSVENFC
DKHLDEYQLNNCIEIASKPGPHILSDWCERLIISISARLHNGAVACKCHSQGSIASSCSK
LGGQCQCKPQVTGRCCDKCSVGTYGLGHHGCHSCECHPQGSKSTICDQVTGQCSCLQNIE
GLCCDQCLAGYFGFPNCQPCPCNGFAELCDPETGSCFNCKGFTAGLNCERCIDGYYGNPS
SGQPCVPCQCPDVPSSNQYFARSCYQNSWTLEVICNCQEGYTGIHCDECSNGFYGNPRIS
GECCLPCPCNNNIDRTDPESCSSSTGECLKCLYNTHGPNCQFCKPGYFGSAPTQNCKRCT
CNLSGVNRTTCPMGDGACLCDPTTGSCPCLPNVVGLACDQCAEGYWNLVPGKGCQFCECD
PENSHSTHCNQARAFFLNGQCPCKLGYGGKHCHKCEENYYADSQMQCIACKCNKEGTQTP
ICDQETGSCLCRAGVTGQFCDRCARGHSQEFPTCLRCHLCFDQWDNKISSLSEAVQGLIR
LAADLEDKRKTLPGCNADFKRLEDSMSEIERILKHPVFSSGEFLNVKDYHDSVRTQVELI
AQQLNREYDFRDLNGTVLGIGKEVDDLLEDLQKKVQLASHVSNSSTRDASEIKKHHQMSL
SAEQKINKTVITIKHSENTRKDLLTMIDGLTSKREFSLENLKQIQAPDIQKLNEKVCGIP
SNLSCALAPCGGALCKDAGGQRICGGPGCNGSIDLSGDALRRAEETESTIHNLTNQLQES
ENWIRNITKLTRLTKTKALQLTEKLENMKGQMETEQRTKGLILKVKDFLLDENVPPEDIE
KVANHVLDFHLPITSQNLTNELEKIELLMKLCEEDQAAGNQLKQKATEAQKLLVASKEVK
EVVNTLLNLEEMLKDLQSAKSIQRQANSTVKQLTDEIQKIEIKIPKVENFTNKTDDELEH
ISSQQSTLEDEISTLKIKILRTRDQIISAKAKAESAQDQANITEKDFIDKKQFTVLQDKT
NSEGSMIGTLRKVKQLKEEAEKLAGETEEKMQRIKALEKKVQVLNQTKQEKVNQLKQLED
HVIAIKNEISEQENQYATCHT
Download sequence
Identical sequences F6YTR2
ENSMODP00000020037 ENSMODP00000020037 13616.ENSMODP00000020037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]