SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020041 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020041
Domain Number 1 Region: 3923-4114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-39
Family Laminin G-like module 0.00049
Further Details:      
 
Domain Number 2 Region: 4176-4373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-39
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 3 Region: 3649-3860
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.16e-30
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 406-491
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 3114-3208
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-19
Family I set domains 0.0077
Further Details:      
 
Domain Number 6 Region: 3582-3670
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 3218-3311
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-18
Family I set domains 0.0076
Further Details:      
 
Domain Number 8 Region: 1869-1968
Classification Level Classification E-value
Superfamily Immunoglobulin 8.44e-18
Family I set domains 0.034
Further Details:      
 
Domain Number 9 Region: 3505-3592
Classification Level Classification E-value
Superfamily Immunoglobulin 8.7e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 3026-3123
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 11 Region: 2536-2618
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 12 Region: 2629-2712
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 13 Region: 2244-2325
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 14 Region: 1683-1773
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000116
Family I set domains 0.03
Further Details:      
 
Domain Number 15 Region: 3301-3389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000255
Family I set domains 0.0082
Further Details:      
 
Domain Number 16 Region: 2340-2426
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000277
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 17 Region: 1781-1864
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000377
Family I set domains 0.000043
Further Details:      
 
Domain Number 18 Region: 1961-2044
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000038
Family I set domains 0.018
Further Details:      
 
Domain Number 19 Region: 2052-2140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000587
Family I set domains 0.049
Further Details:      
 
Domain Number 20 Region: 3409-3501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000658
Family I set domains 0.011
Further Details:      
 
Domain Number 21 Region: 2730-2812
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000665
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 
Domain Number 22 Region: 2437-2522
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000984
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 23 Region: 2156-2235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000126
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 
Domain Number 24 Region: 2827-2912
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000195
Family I set domains 0.057
Further Details:      
 
Domain Number 25 Region: 2934-3012
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000377
Family I set domains 0.079
Further Details:      
 
Domain Number 26 Region: 1568-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 27 Region: 325-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 28 Region: 282-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 765-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000893
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 30 Region: 368-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 1163-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 32 Region: 3856-3896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 33 Region: 825-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000523
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 34 Region: 196-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 4118-4161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000479
Family EGF-type module 0.011
Further Details:      
 
Domain Number 36 Region: 1627-1675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000703
Family Laminin-type module 0.069
Further Details:      
 
Domain Number 37 Region: 1279-1327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 38 Region: 1222-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020041
Domain Number - Region: 887-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1127-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00451
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 726-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0164
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 1533-1570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 3898-3935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0512
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020041   Gene: ENSMODG00000016051   Transcript: ENSMODT00000020398
Sequence length 4402
Comment pep:novel chromosome:BROADO5:4:356360432:356467480:1 gene:ENSMODG00000016051 transcript:ENSMODT00000020398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAWAAPWLYGLVMGLHFGIPQVVHGRTAYDGLSLPEDAERETAVVRPHWNYTDLSDDEDL
LADEASGDGLGSGDLGSGDFQMVYFRAMVNFTRSIDYSPHLEDAGSQEFRDVSEAVVDTL
ESEYLKIPGEQVVSVVFIKEVEGWVFVELDVGSEGNSDASQIQEVLYSVVSSGSIASYLT
STAGFQFRRLGTVTPASRLCTDKEFACRTHNECIALEYRCDRRPDCRDMSDELDCGEGSC
YLFPEETVPPEPTVPPPRTPAPTTQQVPWTVAPQSLLPPGSPRLCGHHEASCTSGQCIPK
NYFCDGQMDCADGSDEENCGDSSLPCEPNEFQCRDGRCALKLWRCDGDFDCEDHTDEENC
PPKLPGDVCAPTEFRCVSTNTCIPSSFHCDEESDCPDRSDEFGCMPPQVVTPPQESVQVS
RGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVKVTSEGGRGTLTIQDVKEADQGAYTC
EAMNARGMVFGIPDGVLELIPQRGPCPDGHFYQEDSSSCLPCFCFGITSLCQGSSRYRDV
IRLQFDRPNDFKGVNVTMPAQPGMPPLSSTQLQVDLESQEFQLVDLSRRFLILDSFWALP
QQFLGNKVDSYGGFLRYKIRYEVSRGFLEPVQKPDVVLLGGGHRLSSRGHTPTHPGHLNQ
RQVQFTEEHWVHDSGRQVSRAELLQTLRNLEAVLLQTVYNNKMASVGLSDVAMDTTSASP
TPHGRVHSVEECRCPIGYSGLSCESCDAHFTRVPNGPYLGTCSGCNCHGHASSCDPVYGH
CLNCQHNTEGPQCNKCKPGFFGDATRGTPTACRPCPCPYIDASRRFSDTCFLDTDGQATC
DACAPGYTGRRCESCAPGYEGNPIQPNGKCKPITNQAIVRCDERGSTGTSGESCRCKPNV
VGRLCNECSDGTFHLSASNPDGCLKCFCMGVSRYCTSSSWNRDQVHGASGAGDHSQFSLS
NAAGTHSTSEGISSPAPGELVFSSFHSLLPSPYFWNLPSRFQGDKVTSYGGELHFTVTQR
PSPGSPALHGQPLVLLQGNEISLEHHPQQEPVPGQPSTFSVPFREHAWRRADGQPATREH
LLMALADIDVIMIRASYAESQVESRLSGLHMDVAVPQVTGLEQAVEVEQCVCPPGYRGPS
CQFCDIGYTRASSGLYLGTCELCSCHGHSVICDPETGACQGCQHHTDGAKCERCQPGYYG
DAQRGSPEDCQPCPCHGMPSNNQGIHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYHGN
PSLGQPCLSDRPGPVPDGCRCDPAGSLSTQCDKASGQCRCKSKVEGPTCSSCRLHHFYLS
AANPEGCLPCFCMGVTQQCASSSYTRHLTSTPFAPGDFQGFTLVNRQRSSRVAGGFIVEP
MPEGSQLSFSNFAHLGHESFYWQLPETYQGDKVDAYGGKLRYILSYTTGAQGSPLSDPDV
QITGNDITLVATQPELQGRERKSFEIMFREHFWRRLDGQPATREHLMMVLADLDEILIRA
TFSSVPLAASIGAVSMERALPGPAAGPRALEVEECRCPPGYRGLSCQDCASGYTRTGSGL
YLGHCELCECNGHSDTCHPETGACSQCLHHTTGEFCELCAPGYYGDATAGTPEDCQPCAC
PLTNPENMFSRTCESLGSGGYRCTACEPGYMGQYCEQCAPGYIGNPSVRGGRCQPQTDQA
LLVVQVHPARSTVPQGGSHSLRCQVSGSPPYYYYWTREDGRSIPSTTQQRQQGSELHFPS
IQPSDAGVYICTCRNLYHANTSRAEILVTEAPTKAITVTVEEQTSQSVRAGANVTFICTA
KSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRDVQPNDAGTYVCTGSNMFAMDQGSAML
HVQASGSLSPPVVSIHPPQLTVQPGQLAEFRCSATGNPAPSLEWSGGPGGQIPRKAWIHG
GILRLPATEPSDQAQYICRASNSAGQHVARAVLHVHGGWMPDVHPRPEQTQVQEGHIVRL
NCQVTGNPPHRIIWTKEGGSLPPKARVEHTMLFIPDATAADAGIYVCSSNTLTGSAQARM
EVVIVPDSGLIPAMRIESSSPSVTEGQTVDLNCVVTGHAHAQVTWYRRGGSLPTQHQAHG
TRLRLHQLTPADAGTYVCRFNGPSGHQEAFIDISVSHAASPDSGHSPGPDASFPMRIEAS
STEITEGQTVDLNCVVPGQAHAQVTWYKRGSSLPVDDHGTWLRLYQVTPADSGEYVCRVV
RGSRPHEASLVITVQPSRSTPATPAPVRIESSSPTVVEGQTVDLSCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYIFQATPADAGEYVCRAANGMEASLMVTVTGSQGASFSYPQDIT
PPIKIESSSSSVAEGQTLDLNCIITGQAHAQVTWYKRGGTLPARHQVHGSRLRLYQVSPA
DSGEYVCRVVGSSSPQEASVLVTIEAEGSNPAQGITPPIRIESSSSSVAEGQTLDLNCIV
AGQAHAQVSWYKRGGSLPAKHQVHGSRLQLYQVSPADSGEYVCRVVGSSSHQEASVLVTI
EAQGSSHAQGVVYPVRIESSSSSLANGQTLDLNCLVASHAPHTITWYKRGGTLPARHRIV
GSRLRIPQVTPADSGEYVCHVSNGAGSQESSLIVTIQGGGSSHSSGITPPIRIESSSPVV
TEGQTLDLNCVVPEHSQATVTWYKRGGSLPAHHQVHGSRLRLNQVTSSDSGEYVCRANNN
IEAQETSIVISILSNNPSNPSSPGATSPIRIESSSSSVAEGQTLDLNCLVSGQAHAQVKW
YKRGGSLPAQHQVHGSQLKLFQVSPADSGEYVCRVISGSGVQEASVLVTIEAAHPNSGSV
PAPGIIPPIRIESSSSSVAEGQTVDLNCVVTGQAHAQVSWYRRGGSLPARHQVHGSRLRL
NQASPADSGEYVCRVLGGPSPQETSILVTIKALGSGTGPVPAVPTAATFIPIRIESSTPS
VTEGHTVDLNCVVAGQPRAQVTWYKRGGTLPARHQVHGSILRLYQVSPTDAGEYVCRVIG
GSGPPQEASFSIAVLPSTAESYRLQSPVISINPPSATVQQGQDATFKCLIHDGAAPISIE
WKMARNQELEDNVHLSPNGSIITIMGARPSNHGTYRCVASNPYGVAHSVVSLSVQGPPTV
SVLPKGPVQVKLGKAISLECVSAGEPRPSARWMRIGTPLKVDHHRTLGPMDSHAVLQITE
AQPEDAGTYVCLAQNALGSAQARVEVSVETGTTALGTPEVRVEEAEMTVEAGKTAILRCS
ATGSPTPTVHWSKLRAPLPWKHQLSGNTLILPEVAQQDSGQYICNATNSAGHAEATVIVH
VESHPYATTIPEEALVGVGEMVQFQCLAHGTPPLTFHWSRVNGSLPRQAAVRGDLLRIHP
TALEDAGQYQCLVTNKVGSAQAFAHLRIQGDGAMTSRLVSAGAHPPVLAPAVHITPQQET
RGIGGSVEFYCAVLSDAGAQIRWFKEGGQLPQDHTVQDGVLRIQNLDQSCQGTYICRAHG
PWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPHVTWSKVGGHLR
SGIVQNEGTIKIARVEQADAGQYRCTATNAAGTTQSHVLLLVQALPQISAPPEVRVPAGS
AAVFPCMASGFPMPDITWTKLEGDLPPDSLLENNVLTLPSVRPQDAGTYICTATNRQGKV
KAFARLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIRINFRPDAADGMLIYNGQKQIP
GPGSPVNLAARQPDFISFGLVGGRPEFRRFDAGSGMATIRHPTPLALGQFHTVTLLRNLT
QGSLIVGNLSPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFVGCVRELRIQG
EEVIFQDLNLTAHGISHCPTCKDRPCQNGGLCRDSESSSYMCTCPAGFTGSRCEHSQALH
CHPEACGPDATCVNRPDGRGYSCRCHLGRFGEKCMEGVTVTTPALSGAGSYLALPALTNT
HHELRLDLEFKPLAPEGLLLFSGGKGAPVEDFVSLAMTGGHLEFRYELGSGTAVLRSTQP
LTLGRWHHVSAERLNKDGSLRVDGRHPVQRSSPGKSQGLNLHTLLYLGGVEPSVALPPSA
NVSAHFHGCIGEVSVNGKRLDLTYSFLGSRGVGQCYDSSPCERQPCQNGATCMPGGEYDF
QCLCRAGFKGDRCEHAENPCLLPEPCLHGGTCQGARCLCPPGFTGPRCQKGQGAPEADWH
LEGSGGNDAPGQYGAYFHDGGFLSFPSRVFPRSHPDVPETIELEVRTHTPNGLLLWQGVE
AREEGRGKDFISLGLKDGHLVFSYQLGSGEAHIISEDPINDGEWHKVTALREGKSGSIQV
DGEEMVSGRSPGPNVAVNTKGSIYIGGAPDAGTLTGGRFDSGITGCIKNLVLHCASPGGP
PPQPLDLQHHVQAGANTRPCPS
Download sequence
Identical sequences F7GIZ7
13616.ENSMODP00000020041 ENSMODP00000020041 ENSMODP00000020041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]