SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020092 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020092
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-19
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Domain Number 2 Region: 78-181
Classification Level Classification E-value
Superfamily TRAF domain-like 1.44e-19
Family SIAH, seven in absentia homolog 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020092   Gene: ENSMODG00000016093   Transcript: ENSMODT00000020449
Sequence length 210
Comment pep:novel chromosome:BROADO5:6:156929788:156931183:1 gene:ENSMODG00000016093 transcript:ENSMODT00000020449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGYDLNLFASPPDCALLCSVCHGVLKRPVKLPCGHIFCKKCILTWLARQKTCPCCRKEV
KRKLMVQVHKLRKTIGRLPVKCKNSQAGCCVTCPLSQRRIHLDSCPFELTPCPNAGCMAR
VQRAALVEHGRSCGHGRQQRCPLGCGATLTAVERESHNCYRELREAWGRRRAQGRALVSR
LRHRMRRIHRATSLIRRQLTRLEAFLEEEE
Download sequence
Identical sequences F7FYT8
ENSMODP00000020092 13616.ENSMODP00000020092 ENSMODP00000020092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]