SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020136 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020136
Domain Number 1 Region: 133-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-51
Family SPRY domain 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020136
Domain Number - Region: 315-351
Classification Level Classification E-value
Superfamily SOCS box-like 0.00288
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020136   Gene: ENSMODG00000016123   Transcript: ENSMODT00000020493
Sequence length 391
Comment pep:novel chromosome:BROADO5:6:156415629:156433525:-1 gene:ENSMODG00000016123 transcript:ENSMODT00000020493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGLGGGDCLRLAREGKVGQSAGLDRSAAVAAPEIFSTMARRTRSSRAWHFVLSGARRE
ADARAVALASGTTNWGYDSDGQHSDSDSEAEFPSLPPSIPSAVPVTGESYCDCESQSETP
YCASLHTSHRSRDCQCGEEDDYFDWVWDDLNKSTATLLSCDNRKVNFHMEYSCGTAAIRG
NKELCEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDEDSWGLSYTGL
LHHKGDKMSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKKFYPMVCSTA
AKSSMKVIRSCASLTSLQYLCCYRLRQLLPDSGDTLEGLPLPPGLKQVLHNKLGWVLSMN
CSPLPSPSPKVAACSGSPEAKPCQRKRCRRT
Download sequence
Identical sequences F7DSS7
XP_007499426.1.35504 ENSMODP00000020136 ENSMODP00000020136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]