SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020159 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020159
Domain Number - Region: 123-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0139
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 561-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 380-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 153-281
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.0029
Further Details:      
 
Domain Number - Region: 508-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020159   Gene: ENSMODG00000016141   Transcript: ENSMODT00000020516
Sequence length 677
Comment pep:novel chromosome:BROADO5:7:233585791:233762582:-1 gene:ENSMODG00000016141 transcript:ENSMODT00000020516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIPLDEDEFEEKEELEVVRFPDLHYRRPSHLLNYAVSSNPNYEDDGGPEERDILGEFTV
LHKVVCLHDTFGHDCSLVCEDCMNGGECNEEKSGCLCPAGWGGILCNETCPPGTYGHECD
GICKCQNGGSCDPLTGQCHCPPGVHGMICEDGCPKGFFGKDCNKKCICAHHSYCHRVYGV
CLCDPGLYGRFCHLTCPKGAYGAGCSSECQCVEENTLDCNAKNGSCTCKSGYQGNRCQEE
CLPDFYGPGCKLPCNCSGLPCDHTTGECQQLCPPGFHGDRCHLECPEGTFGVRCGFSCQC
KNGAVCDPVSGACFCPAEWTGRFCEEGCQKNPEGEGCGQVCNCHNGARCDPETRQCICTS
GWTGPTCQEGCPDGTYGPYCQKMCQCMNGGHCDPLLGTCDCPPGFIGTDCSQACPENHYK
RNRALLYFCSPGQCDPKTSRCQCLPGHSGLSCQQICPQERYGQDCQLPCACKNGGLCNPT
YGNCTCGLGWSGIHCEEACLPGTYGPSCHLNCSCQNNGTCNRFTGFCQCPEGYYGHSCEH
RCPLGFYGSDCTHPCDCTNGARCDAENGKCICLPGYHGSHCEKGRCPFGTFGDRCQQLCD
CEGAGPCHPVTGKCLCPPGRTGDKCDTECKSDQYGPDCSLQCQCPLGYQCNPQNGTCACP
FQRMGPTCEESDSEKKQ
Download sequence
Identical sequences F7DRT7
ENSMODP00000020159 ENSMODP00000020159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]