SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020216 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020216
Domain Number 1 Region: 283-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-34
Family Pentraxin (pentaxin) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020216
Domain Number - Region: 101-212
Classification Level Classification E-value
Superfamily Tropomyosin 0.0242
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020216   Gene: ENSMODG00000016175   Transcript: ENSMODT00000020573
Sequence length 492
Comment pep:novel chromosome:BROADO5:6:155811883:155816774:-1 gene:ENSMODG00000016175 transcript:ENSMODT00000020573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCWEAKWRSLFLVLLPFCLQGIYLQKTDEVGQRKPFFERLRRLEEQFRRFQEVTLIRLQ
GIAENYNVSYNINARFQNLTDEYHIMGLSVNESQAAMQMDLNHLKTWIKKFQRRSRKVDS
KLLAFERSLSEKSKQSSQEKKEQQGHDTRLANLTGTISRDISALQTSQIHVQTEMEKLQN
MIHGQGAKLKVVEEQLQAALQRAAFSPSSVTTVPLLPQPLVEKKQPGQQMLHTKHKHRKK
LEQDRLELGAQTETQELFEEGREADLFQVLTRRFLSPPSVCNVGSMLVFPNASTENVVTF
RPGFRTGLRELSLCTWVRTASSYLGTLLSYATEENDNKLVLHGRDSLVYGSIHFVIGDPA
FRELPVEMLLDARWHHMCVIWSSDQGKYWFYVDRRLVATGSRFREGYEIPPGGTLVLGQE
QDTVGGGFDSSEAFVGSLAGLALWDRVLSPGEVSSIATGKMLPTGILLTLANASSLDGFV
QKVICTCLEHCS
Download sequence
Identical sequences F7G8Q0
ENSMODP00000020216 13616.ENSMODP00000020216 ENSMODP00000020216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]