SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020217 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020217
Domain Number 1 Region: 546-766,793-894
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.97e-66
Family Pancreatic carboxypeptidases 0.00000503
Further Details:      
 
Domain Number 2 Region: 372-528
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.06e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 894-986
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.84e-20
Family Carboxypeptidase regulatory domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020217   Gene: ENSMODG00000016176   Transcript: ENSMODT00000020574
Sequence length 1114
Comment pep:novel chromosome:BROADO5:1:501473699:501495987:1 gene:ENSMODG00000016176 transcript:ENSMODT00000020574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPSPRGAPFLPLLCCLLGLLTLCPGGEPQTVLTDDEIEEFLQGFLQELDPQRKEEGEG
EEKEVEQGLPETTLSPKKGKAGGSPEKAKDKGKKGKKDKGPKPTKGPLETTPKPTKKGKE
KPPKATKKPKEKRPKATKKPKEKRPKTTKKPPTGRKSPPTLFPLEDLERPVAPAPIPEPQ
PDEETQRGGSNLPPWEDQEGVHTDLIRREFQPEEEEETEPPTLDYNDQIEREDYEDFEYV
RRQKKPKPPPSRKKPERPRPEPPEELKPEERPDSFKPPPPLQIPDYGDGYVIPDYDDMDY
YLRPPRPRKPDNELETDEEKERLKKPKKEGGSNKEEEPDEKWPEEKGKDRKGKPKKPWGT
EEEWGPVEKEKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNIQAGSNEDDYYDGAW
CAEDDTQVQWLEVDTRRNTKFTGVITQGRDSTIHDDFVTTFFVGFSNDSQNWMMYTNGYE
EMTFHGNVDKDTPVLSEFPEPVVARFIRIYPLTWNGSLCMRLEVLGCPLTAIHSFYTQNE
VMTTDNLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSFKGLKIYAMEISDNPGEHEL
GEPEFRYTAGIHGNEVLGRELLLLLMQYMCREYKDGNPRIRSLVHDTRIHLVPSLNPDGY
EIAAQMGSEFGNWALGLWTEEGFDISEDFPDLNTVLWGAEERKWVPHRVPNNNLPIPDRY
LTADATIAVEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPNREQLMAAAMAAAR
GEEEDETFEIQETPDHAIFRWLAIAYSSAHLTMTETYRGGCQAQDYTNGMGIVNGAKWNP
RVGSMNDFSYLHTNCLELAIYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVT
DEQGIPIANATISVNGINHGVKTATGGDYWRILNPGEYRVTARAEGYTPSAKTCNVDYDI
GATQCNFILARSNWKRIREILAMNGNRPIPHIDPSRPMTPRERFMQRRRMMYRIKMREQM
RLRRLNATASPAPTTSSSPIYLPSQSTTLEPWSLQPPTAPTWEMETETETYTEVMTELAT
ELEPEFGPEEDELATGTAFPFTTAETYTVNFGDF
Download sequence
Identical sequences F7G8P6
ENSMODP00000020217 XP_007475908.1.35504 ENSMODP00000020217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]