SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020347 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020347
Domain Number 1 Region: 326-503,538-704
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-84
Family YicI catalytic domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 1198-1392,1437-1598
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.73e-75
Family YicI catalytic domain-like 0.00046
Further Details:      
 
Domain Number 3 Region: 82-325
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-47
Family YicI N-terminal domain-like 0.012
Further Details:      
 
Domain Number 4 Region: 948-1195
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.89e-44
Family YicI N-terminal domain-like 0.0096
Further Details:      
 
Domain Number 5 Region: 1601-1681
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.37e-16
Family Putative glucosidase YicI, domain 3 0.011
Further Details:      
 
Domain Number 6 Region: 707-787
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-16
Family Putative glucosidase YicI, domain 3 0.018
Further Details:      
 
Domain Number 7 Region: 921-971
Classification Level Classification E-value
Superfamily Trefoil 0.0000000303
Family Trefoil 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020347   Gene: ENSMODG00000016273   Transcript: ENSMODT00000020704
Sequence length 1798
Comment pep:novel chromosome:BROADO5:7:237850947:237951197:1 gene:ENSMODG00000016273 transcript:ENSMODT00000020704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFSGLEISLIVLFTIVSIIAVALVVVLATKTPAVRGKDKDPETELVSGDEPTPGKCPSD
VNINPDRRINCIPDQFATEKICAQRGCCWSPLNTTTYPWCIYGDNHGYKVDSTEKTSAGM
QVRLSRISSPTIFGNDIDNVLLTTESQTASRLRFKITDPSKKRYEVPHQHVQAFTGSEAS
NAKYNIEVSNSPFSIKVIRKSNNRVLFDTSVGPLVYSDQYLQISTKLPSNYFYGIGEHIH
KRFRHDTYWKNWPIFTRDELPGDNNHNLYGHHTFFTCIEDNTGLSFGVFLMNSNAMEMFI
QPTPIITYRVTGGILDFYIFVGDNPEQVVQQYVEFIGRPAMPAYWGLGFQLSRWNYGTLD
EVKKVVERNRAAGIPFDVQVTDIDYMEEKKDFTYDLDKFAGLPEFVQDLHNHGQKYVIIL
DPAISIGKRLNGAAYDTYIRGSQQDVWVKNADGQTPLVGEVWPGLTVFPDFTSSACTEWW
ANECKFFHDTVPYDGLWIDMNEVSSFIRGSSEGCEPNKLNYPPFTPGILDRLMYSKTICM
DAVQHWGSQYDVHSLYGYSMTIATEKAIERVFPNKRSFILTRSTFAGTGKHAAHWLGDNT
ALWEHMEWSITGLLEFSLFGIPYAGADICGFIGDTSEELCTRWMQLGAFYPFSRNHNAEN
YISQDPAAFGENSVLVRSSRHYLNIRYTLLPFLYTLFYKAHVYGDTVARPFLHEFYTDEN
SWIEDTQFLWGPSLLITPVLKQGADIVSAYIPDAVWYDYETGGKRPWRKERVEMYLPIDK
IGLHLRGGYIFPIQQPNVTTTASRNNPLGLIIALDENKEASGDFFWDDGESKDSIEKGNY
LFYNFSVTAVSIFLGSMSSSFTSSLAFEEIKILGFQYGATNITVTDLNNNVLTSNHQLSH
DPSNQVLQITGLKLQLGQSYRLKWTSTFPLKERFGCYPDDDGETMEKCQARGCLWNAATD
GTNAPRCYYPSEENPYAVSSIRYSSNGITADLKMTPGTQRSLPYPNPIPNLRLEVKYHKN
EMLQFKIYDADKKRYEVPVPLNISSSPSSTYEGRLYDVEIKEKPFGIQIRRRSTGVVIWD
SQLPGFAFHDQFIQISTRLPSEFLYGFGEVEHTAFKRDLNWHTWGMFTRDQPPGYKLNSY
GFHPYHMVMENEGNAHGVLLLNSNGMDVTFQPTPALTYRTLGGILDFYMFLGPTPEGATR
QYHELIGHPVMPPYWALGFQLCRYGYRNTSEISSLYDEMVKAQIPYDVQYTDIDYMERQL
DFTLNRPRFQDLPQFVDKIRRDGMKYIIILDPAISGNETDPYPAFTKGVEQDVFVKWPNT
DEICWAKVWPDLPNVTIDESLTEDEAVNASRAHVAFPDFFRKNTTDWWTNEIVDFYNNVM
KFDGLWIDMNEPSSFVNGTTTNVCRNDSLNFPPYFPALTKRGEGLHFRTMCMETEQILSD
GTSVLHYDVHNLYGWSQVKPTYDALQKATGKRGIVISRSTYPTGGQWGGHWLGDNYAEWS
NLDKSIIGMMEFSLFGISYTGADICGFFNNSEYELCTRWMQLGSFYPFSRNHNIAKTIRQ
DPVAWNETFANMSRDVLNIRYTLLPHFYTLMHEIHANGGTVIRPLLHEFFDDKETWIIFK
QFLWGSAFMVSPVMEWGATSVRAYVPDARWFDFHTGLDIGIRKIYHDFDAPLEKINLHVR
GGHILPCQEPAQNTVHSRKNFMGLIVAMDENHMAQGSLFWDDGDSIDTYEKGQYLLVHFK
LNQNTLTSSVTHNGYSNPEELRLGYIKVWGESQTQISSVELIYNGQTQSVTHKYDLTN
Download sequence
Identical sequences F7BGM0
ENSMODP00000020347 ENSMODP00000020347 13616.ENSMODP00000020347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]