SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020348 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020348
Domain Number 1 Region: 325-498,533-699
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.85e-83
Family YicI catalytic domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 1194-1313,1349-1395,1440-1601
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-74
Family YicI catalytic domain-like 0.00098
Further Details:      
 
Domain Number 3 Region: 81-324
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-47
Family YicI N-terminal domain-like 0.0091
Further Details:      
 
Domain Number 4 Region: 943-1191
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.38e-45
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 5 Region: 1604-1684
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.32e-19
Family Putative glucosidase YicI, domain 3 0.014
Further Details:      
 
Domain Number 6 Region: 702-782
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.44e-16
Family Putative glucosidase YicI, domain 3 0.016
Further Details:      
 
Domain Number 7 Region: 914-963
Classification Level Classification E-value
Superfamily Trefoil 0.00000000654
Family Trefoil 0.0044
Further Details:      
 
Domain Number 8 Region: 1817-1869
Classification Level Classification E-value
Superfamily Trefoil 0.00000000824
Family Trefoil 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020348
Domain Number - Region: 1846-1919
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00345
Family YicI N-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020348   Gene: ENSMODG00000000054   Transcript: ENSMODT00000020705
Sequence length 1920
Comment pep:novel chromosome:BROADO5:8:204627118:204727563:1 gene:ENSMODG00000000054 transcript:ENSMODT00000020705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKNFSKLEIILSFLLFILFIISVALIVILATNTSSVNASSIVNSTTTSQTTTIAAECP
AANQSERINCIPDQTPTQTTCSQRGCCWSPQGPENIPLCYFPKKYGYQIRNSTYSRTGFT
AHLNRLPTPSMFGNDIANVILTAEYQTANRFHFKISDPSEARYEVPHEHVQLFPGNATSN
LNYHVDCVEEPFSIKVTRKSNNRVLFDTGIGPLQFAQQYLQLSIQLPSANVYGLGEHVHQ
QYRHDMDWKTWPIFSRDTTPNEDMTNLYGAQTFFLCLEDTSGASFGVFLMNSNAMEVTLQ
PAPAITYRVIGGVLDFYVFLGNTPEEVVREYLELIGRPFLPSYWSLGFHLSRWVYGGLDG
MKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFNGLPEFVEDLHNHGQKYVIIMD
PAIFINSSNYGPYIRGSDMKIWILFINGHALHLWRVWPGQTVFPDYTNPKCAQWWAEEFR
LFYRELKFDGIWIDMNEPSNFENGSSIGCSHNTLNSPPFIPRILDRYLPSKTLCMDAVQH
WGKHYDVHSLYGYSMAIATEEAVKTVFPNKRSFIVTRSTFAGSGKFAAHWLGDNAATWND
LRWSLPGMLEFNLFGIPMVGPDICGFTYNVSEELCRRWMQLGAFYPFSRNHNGEGYKDQD
PAAFGKDSLLLNSSRHYLNIRYTLLPYLYTLFFRAHTRGDTVARPLLHEFYEDSNTWAVY
RQFLWGPGLLITPVLDEGAKNVTAYLPDAVWYDYETGGQIPERKQQVEMLFSPEQIGLHL
RGGYIFPIQQPAITTVASRKNPLGLIIAPDDNKEARGELFWDDGETKGTIASGSYILHEF
LFTQNRLDMKVLHQSYNDPNNLAFEEIKILGTEEPTNITVKKNNVPIASSPNVTYFEKDR
VAMISGLELALGEEYTVEWSIKFREVIKIDCYPEDQAVSEENCTARGCAWELSNSPGVPN
CYVINHLYSVSSIQYNPTGITADIFLNSPVRASNLLSAGLSTPVNPLRLDVTYHKNDMLQ
FKIYAANSKRFEVPVPLNIPSSPSSTAENRLYEVLIKRDPFGIEIRRRSTGTIIWDSQIP
GFTFNDMFLRISTRLPSQYVYGFGETEHTTFRRNLTWHTWGMFSRDQPPEYKKNSYGVHP
YYMGLEDDGKAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTE
LVGRPVMTPYWALGFQLCRYGYQNDAEIAELYDAMVAAQIPYDIQYSDIDYMERQLDFVL
SSKFAGFPDLINRMKEAGMRVILILDPAISGNETQPYPPFLRGVEDDVFIKWPDDNGIVW
ERKVVWPDLPNVTVNTSLDWDTQVELYRAHVAFPDFFRNSTVKWWKRELLELYNNPQEPE
KSLKYDGLWIDMNEPSSFVNGAVSPGCRNTTLNHPPYMPYLEARDRGLSSKTLCMESQQF
LPDGSPVTHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGHWLGDNKS
TWDQLYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNALGT
KRQDPVAWNSTFEDLSRSVLKTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFIEDKETWD
IFLQFLWGPAFLVSPVLEPNSRQVSAYFPRARWYDYYSGSDIGVRGQWKDLSAPLDHINL
HIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGESIDTYEKGNYYFS
TFSASEKHLDVKVFQQNYQDPNHLAFKEIKIFGLNFQPFLVTVKENNIPIQSDAEIKYDP
ATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCKLRDCVWEPTNSTG
VPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLDVTFHKNHMLQFKV
Download sequence
Identical sequences F7BGL5
ENSMODP00000020348 ENSMODP00000020348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]