SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020352 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020352
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-52
Family Calnexin/calreticulin 0.000000408
Further Details:      
 
Domain Number 2 Region: 144-248
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.92e-33
Family P-domain of calnexin/calreticulin 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020352   Gene: ENSMODG00000016281   Transcript: ENSMODT00000020709
Sequence length 268
Comment pep:novel chromosome:BROADO5:6:143009996:143011514:-1 gene:ENSMODG00000016281 transcript:ENSMODT00000020709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPRSGFSARLNKPFTFDTKPLIVQYEVNFQSGIECGGAYVKLLSRTPELNMDQFHNKTP
HTIMFGPDKCGEDYKLHFIFRKNPKTDIYEEKHAKRSDMDLKTYFTDKKTHLYTLVLNPD
NSFEILVGQMVVNSGNLLNDMTPPVNPPQEIEDPNDQKPEDWDERPKIPDDVVKPDDWDG
TVPAKIPDEDATKLEGWLDDEPEYVYDPDAEKPENWDEDMDGEWKAPQIANSKCESAPGC
GVWTWDIPYMLKPRKTSRFHYQQIPVKH
Download sequence
Identical sequences F7AUN4
ENSMODP00000020352 13616.ENSMODP00000020352 ENSMODP00000020352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]