SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020372 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020372
Domain Number 1 Region: 22-495
Classification Level Classification E-value
Superfamily Cytochrome P450 5.4e-48
Family Cytochrome P450 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020372   Gene: ENSMODG00000016298   Transcript: ENSMODT00000020730
Sequence length 518
Comment pep:novel chromosome:BROADO5:1:496667852:496720738:1 gene:ENSMODG00000016298 transcript:ENSMODT00000020730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWFFVAALLAALLLLLLLSRRRMRRPGEPPLDLGLIPWLGHASEFGKDAARFLSRMEGK
HGDIFTVLVAGRFVTVLLDPHSYDTVVWESSSKLDFHKYAIFLMEKIFDVQLANYNPSME
KAKIKPTLLHKNLHALTEAMFNNLCNILLRDAGDIGKDWKETGLFQFSYNVMLRAGYLTL
YGTEGDDPVSQAQDRTHSEEVFQSFRQLDQLLMKLARSSLSAEEKKEASHIKARLWKLLS
PQGLMGRAHRSAWLDSYHQYLQDLGAAEEKQARAMLLQLWSTXGNAGPAAFWLLTFLLKT
PTALAAVLGELESTLQKEGQVLTQMASIPQGVLDNMPIFDSVLSESLRLTAAPFITREVL
EDLVLPLADGREYSLRQGDRLLLFPFLSPQKDPEIYEDPEVFKYNRFLNQDGSEKRDFYK
GGKRLKNYNLPWGAGTNMCLGRSHAISSIKQFVIILLMQFDLKLKNPEEKIPSFDTSRYG
FGLMQPEHDITICYRFKPRETPGSTGLSFPAPDGITEA
Download sequence
Identical sequences F7ATG7
ENSMODP00000020372 ENSMODP00000020372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]