SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020390 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020390
Domain Number 1 Region: 868-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 2 Region: 336-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 3 Region: 774-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 272-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000942
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 5 Region: 822-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 6 Region: 977-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 511-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 459-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 929-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 10 Region: 1085-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1029-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 12 Region: 416-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 13 Region: 1133-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020390
Domain Number - Region: 1452-1688
Classification Level Classification E-value
Superfamily Tropomyosin 0.00317
Family Tropomyosin 0.0028
Further Details:      
 
Domain Number - Region: 1187-1308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020390   Gene: ENSMODG00000016246   Transcript: ENSMODT00000020748
Sequence length 1787
Comment pep:novel chromosome:BROADO5:8:159833412:159928549:-1 gene:ENSMODG00000016246 transcript:ENSMODT00000020748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMGLLQVHLFGFLALWGVSVQAQEPEYSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLH
KPEPYCIVSHLQEDKKCFMCNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVE
NVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGVST
GPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVK
LHTLGDNLLDSRIEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGHSEEVEGMVHGHCM
CRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSGSCHFDMAVYLATGNISG
GVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNICAACTCDPAGSKNGGICDGYTDFST
GLIAGQCRCKLYTEGEKCDICKEGFYGLSADDPFGCQSCACNPLGTIPGGNPCDSETGYC
YCKRLVTGQHCDQCLQEHWGLSNDLDGCRPCDCDVGGSLNNNCSAESGQCLCRPHMIGRQ
CNEVEAGYYFTTLDHYIYEAEEAHFGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEF
FIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPTSSRCGNTVPDDDNQSVSLSP
GSRYVVLPRPVCFEKGVNYTVRLELPHYTSSDSGIESPYTLIDSLVLMPYCKSLDIFTVG
GSGDGLITNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQSGLACECDPQG
SLSSVCDPNGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCKPCDCHVQGSVNAFCDPVTGQ
CHCFQGIYTRQCDQCLRGYWGFPSCQPCQCNGHADDCDPISGECFGCQDYTSGHNCERCL
PGYYGDPVIGSGDHCRPCPCPDGPESGRQFANTCYQDPVTLQLVCVCNPGYLGARCNECA
SGYFGNPEDVDGVCQQCQCHNNIDTTDPEACDKRTGRCLKCLYHTEGENCQLCKYGYYGD
ALQQDCRKCVCNYLGTVQEHCDGSDCQCDKITGQCLCLPNVIGQNCDHCAPNTWNLASGT
GCEPCSCDAAHSFGPSCNEFTGQCQCMPGFGGRTCDECQELFWGDPNVKCQACDCDPRGI
EIHQCDRVTGQCVCIEGVEGPRCDKCTRGYSGIFPDCAPCHECFALWNAIIAELTNRTHK
FLEKAKALKISGVIGPYRETVDNVEKKINEIKSILAQSPAAEPLKNIGNLFEEAEKLTKD
VTEKMSEVEAKLSDAASKSNSTVEELDSLQMDAQSLDKTVKELAEQLEFIKNSDIRGALD
SITKYFQISLEAEERVNASTTDPNSIVEQSAFTRNKVEELMMERETQFREKQEEQSRLLD
ELAGKLQSLDLSAAAEQTCGTPPGASCAETPCGGPSCRTDDGEKKCGGPGCDGLVTVAHN
AWQKAMDFDRDVLSALAEVEQLSKTVSEAKLRADEAKQSAQAVLLKTNATKEKVDKSNED
LRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEV
ILQQSAGDIARAEMLLDEAKRASKSATDIKVTTDMVKEALEEAEKAQIAAEKAIKQADED
IQGTQNLLTSIESETAASEETLYNASQRISELERNVEELKRKAAQNAGEAEYIGQVVDTV
KQSADHVKKVLDSELSGKYKRVENLIAKKTEESVDARKKAEMLQNEAKMLLAQANSKLQL
LKDLEQKYEDNQKYLEDKAQELVKLEEEVRLLLQDISQKVAVYSTCL
Download sequence
Identical sequences F7A5M5
13616.ENSMODP00000020390 ENSMODP00000020390 ENSMODP00000020390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]