SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020489 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020489
Domain Number 1 Region: 57-514
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-101
Family Cytochrome P450 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020489   Gene: ENSMODG00000016400   Transcript: ENSMODT00000020851
Sequence length 514
Comment pep:novel chromosome:BROADO5:1:491134495:491156903:1 gene:ENSMODG00000016400 transcript:ENSMODT00000020851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPIRKSPYVAAFMKQIRGLRQPPRPVTSSVCGPQPPEAPPICPLMVPSEVQSASALPG
PTNWPLLGSLLEILWKGGLKKQHHTLAEYHKKFGKIFRMRLGSFDSVHLGSPCLLEALYR
KESMYPQRLEIKPWKAYRDYRQEGYGLLILEGKDWQRVRSAFQKKLMKPTEIMKLDDKIN
EVLADFMQRIDDLCNEDGQIEDLYSELNKWSFESICLVLYEKRFGLLQNNASEDALNFIT
SIKTMMSTFGRMMVTPVELHKTLNTKVWQMHTQAWDNIFKAVKSCVNNRLEKHLENPSED
FLCDIYHHNQLSKKELYAAVTELQLGAVETTANSLLWVLYNLSRNPRVQKKLLEEIERIL
PDHRSPNAEDLKNLPYLKACLKESMRLTPSVPFTTRTLDQETVLGDYALPKGTVLMLNTQ
FLGSNEENFEDWSQYRPERWLQEKKKIHPFAHLPFGIGKRMCIGRRLAELHLHLALCWIV
RKYNIVAIDDEPVEMLHLGLLVPNRELPIAFLAR
Download sequence
Identical sequences F7E8Y4
ENSMODP00000020489 XP_001378276.1.35504 13616.ENSMODP00000020489 ENSMODP00000020489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]