SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020492 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020492
Domain Number 1 Region: 710-811
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-23
Family Cadherin 0.0028
Further Details:      
 
Domain Number 2 Region: 812-918
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 497-613
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 610-717
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-19
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 141-257
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 920-1027
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 1032-1144
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 8 Region: 1132-1250
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 389-509
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000485
Family Cadherin 0.0074
Further Details:      
 
Domain Number 10 Region: 290-387
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000124
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020492
Domain Number - Region: 69-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.0487
Family Cadherin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020492   Gene: ENSMODG00000016351   Transcript: ENSMODT00000020854
Sequence length 1401
Comment pep:novel chromosome:BROADO5:1:42491982:43619299:-1 gene:ENSMODG00000016351 transcript:ENSMODT00000020854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQFSLWKWLPFGIILGTLFPFGSGQHDDDCKLARGGPPATIVAIDEESKNGTIIVDNM
LIKGTAGGPNPTIELSLKDNTDYWVMLDPIRQMLFLNSTGRVLDRDPPMNIHSIVVKVQC
VNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDID
DGPNGQIEYVIQYNPDDPTSNDTFEIPLTLTGTVVLRKRLNYEDKTRYYVIVQANDRAQN
LNERRTSTTTLTIDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIIV
TPPIQAIDQDRDIQPPSDRPGILFSILVGTPEDYPQYFHMHPRTAELSLLQPVNRDFYQK
FDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGSTISDSLNL
TTPLRIVVLDKDIEDTKDPEVHLFLNDYTSVFTVTPSGITRYLTLLQPVDREEQQYYTFS
LTAFDGVQESSPVTVNIKVIDANDNTPTFPAISYDVYVYTDMSPGDSVIQLTAVDADEGS
NGEITYSILVGDQGDFVINKTTGLVTIAPGVELTVGRTYALTVQAADNAPPEERRDSICT
VYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAVLLNLQATDREHDPITYAMKKETLNEF
SIFSETTGILTLGKALDRESTDRYILIVTAHDGRPDGTSTATVNIVVTDVNDNAPTFDPY
LPRNLSVVEEEANAYVGQVRATDPDAGINGQVHYSLRNFNNLFWITSNGTIYTRVKLNRE
VRDYYELVVVATDGAVHPRYSTLTLAIRVLDIDDNSPVFTNSTYTVVVEENLPVGTTFLQ
IEATDVDLGAIVSYRIRSPEVKHLFALHPFTGELSLLESLDYESFPENEAYITFLVEAFD
IGGTMPPGIATVTVIVKDMNDFPPVFSKPLYKGMVAPDAVKGTLITTVFATDADPPGLPA
SHIRYRVEDRQYPYPASIFDIEEDTGRVITRVNLNEEPSTIFKLEVVAFDDGEPVMSGSA
TVKILVLHPGEIPRFTQEEYRPPPVSELAPIGTPVGVITAAAINQSIVYSIVSGNEDDHF
GINNVTGVIYVKSLLDYETKTSYVLRVQADSLEVVLANLRVPSKSNSAKVYIEVQDENDH
APVFQKKLYIGGVSEEALMFSSVLRVKATDKDTGNYSAMAYRLIIPPIKEGKEGFVVETY
TGLIKTAMLFKNMRRSYFKFQAVATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLV
EQNIEELTEILDRYVQEQIPGAKVVVESIGARRFGEAYSQEDYTKSDLVVYAIDPQTNRA
ISRNELFKFLDGKMLDINKDFQPYYGEGGRILEIRTPDAVALVKKHGQSFGYTEGALLAL
AMIIILCCIPAILVVLVSYRQ
Download sequence
Identical sequences F7E8Q5
ENSMODP00000020492 ENSMODP00000020492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]