SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020506 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020506
Domain Number 1 Region: 828-1079
Classification Level Classification E-value
Superfamily RNI-like 1.96e-64
Family 28-residue LRR 0.024
Further Details:      
 
Domain Number 2 Region: 645-893
Classification Level Classification E-value
Superfamily RNI-like 1.67e-55
Family 28-residue LRR 0.0089
Further Details:      
 
Domain Number 3 Region: 166-246,281-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000138
Family Nitrogenase iron protein-like 0.084
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020506
Domain Number - Region: 13-64
Classification Level Classification E-value
Superfamily DEATH domain 0.00137
Family Caspase recruitment domain, CARD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020506   Gene: ENSMODG00000016414   Transcript: ENSMODT00000020869
Sequence length 1086
Comment pep:novel chromosome:BROADO5:6:146718807:146761886:1 gene:ENSMODG00000016414 transcript:ENSMODT00000020869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLKQLLQAISSPLLEILGSMKKQEVVAEEEFSLVQGAGSPTQKVKALIDLLAGKGSQGFQ
AGQDLTENSAAPLSLHNSGMQKHLEVLLSRYGVSVDLDLLSEKAASERLTNLLLVEGLTD
LQLKEHDFTQIEATRGQRRVAKTIPLERLFLPLSKVSIPPRISVTVGVAGIGKTTLVAQY
VSKWARREISKDISLVLPLNFRELNIYEKLSAERLVRSVFPHISETGLTWLGSGQVLMIL
DGLDEFKVALDFSNTVACTDPKKEVPVDNLITNIIRGNLFPEVSIWVTARPTAASQIPGG
LVDRMTEIRGFNEVEIQAYLSQMFPDSHDLPGQVLSQVQANKALYLMCTVPSFCRLCGTV
LGYLVRNGLGCQSSELAPPRTLSEIYSWYFKIALCGEGQDRWRESPRIEQAVHSGRKMMG
TLGRLAFHGLLRKKYVFYEQDMKAFGVDLPLLQSSLCSCFLLREETPTSSAYCFIHLTLQ
EFAAAAYYYNAAKRAIFDLFTESGMSWPKLGFLTHFKNAVQRASQEDNGQLDVFLRFLSG
FLSPQVNSVLASWFLGRDEHNSYRVQALAHLQGYLRADTPISSRTVNVLRCLHELQYTEL
ARAVEEGLESENLAGLLDPMHRSALAYLLQVSEICAQETNLTRCLNYAILKSLLPQLLYC
RNLRLDNNQFQDNVMELLGSVLSSKDCYIQKISLAENQIHNKGTKSLARSLLVNRSLTVL
DLRSNSIGPQGAKALADSLKINRVLVSLSLQNNAIKDDGAKFVADALMVNHKLSVLQLQK
NTIGPLGAKSIADALKKNGSLKELIFSSNSVGNDGSKALAEALKVNQSLITLDLQSNSIS
DAGVTALTHALRSNQTLLSLNLRENSISPEGARDIASALCSNRVLQNLDLTANLLQDEGA
QAIALAVKENRALKSLHLQWNFIQANAAKALGQALQSNRSLTILDLQENAIGDEGMMALS
RALKINTSLTALYLQVASIGVLGAQALGDALAVNRTLEILDLRGNSIGADGAKAMANALK
INPSLQMLNLQENSLGMDGAICIATALSGNHGLQHVNLQGNHIGESGARMISEAIKTNAP
NCIVEM
Download sequence
Identical sequences F7AT33
ENSMODP00000020506 ENSMODP00000020506 13616.ENSMODP00000020506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]