SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020540 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020540
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000388
Family TNF receptor-like 0.00035
Further Details:      
 
Domain Number 2 Region: 53-76
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000171
Family TNF receptor-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020540   Gene: ENSMODG00000016447   Transcript: ENSMODT00000020905
Sequence length 102
Comment pep:novel chromosome:BROADO5:4:389351978:389352566:-1 gene:ENSMODG00000016447 transcript:ENSMODT00000020905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSRVWQRCNSSRDTVCQCTAGTQPVEAFKQGVECSRCPLGHFSPGGNTKCKPWTNCTAL
GKRTLRAGSSEADADCEDLDVSPALPKPSNVPRELRPPAPLP
Download sequence
Identical sequences F7A498
ENSMODP00000020540 13616.ENSMODP00000020540 ENSMODP00000020540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]